- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for anti-PRMT5 (ARP40185_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Unconjugated |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT5 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-PRMT5 (ARP40185_T100) antibody is Catalog # AAP40185 (Previous Catalog # AAPS01710) |
| Sample Type Confirmation | PRMT5 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Azzouz,T.N., (2005) J. Biol. Chem. 280 (41), 34435-34440 |
| Gene Symbol | PRMT5 |
|---|---|
| Gene Full Name | Protein arginine methyltransferase 5 |
| Alias Symbols | HSL7, JBP1, SKB1, IBP72, SKB1Hs, HRMT1L5 |
| NCBI Gene Id | 10419 |
| Protein Name | Protein arginine N-methyltransferase 5 |
| Description of Target | PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription. |
| Uniprot ID | O14744 |
| Protein Accession # | NP_001034708 |
| Nucleotide Accession # | NM_001039619 |
| Protein Size (# AA) | 620 |
| Molecular Weight | 68kDa |
| Protein Interactions | UBC; TP53; ING2; PRDM1; NFE4; WDR5; SUMO2; WWOX; CDYL2; LENG8; LDHAL6B; PRPF38A; ING5; ZNF436; WDR77; GRHL3; TRIB3; RSRP1; LUC7L; RBM23; GTPBP2; H3F3C; FOXK1; ZUFSP; FAM76B; NUDCD2; MAGEB2; NELFCD; COPS4; COPS7A; DCAF8; SPAG8; SLU7; MCRS1; CUL4A; ZNF2; YW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "PRMT5 Antibody - N-terminal region (ARP40185_T100)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
This target may also be called "HSL7, JBP1, SKB1, IBP72, SKB1Hs, HRMT1L5" in publications.
-
What is the shipping cost for "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "68kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PRMT5 Antibody - N-terminal region (ARP40185_T100)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PRMT5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PRMT5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PRMT5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PRMT5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PRMT5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PRMT5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
