SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40196_T100
Price: $0.00
SKU
ARP40196_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRMT2 (ARP40196_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: ESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILIL
Concentration1.0 mg/ml
Blocking PeptideFor anti-PRMT2 (ARP40196_T100) antibody is Catalog # AAP40196 (Previous Catalog # AAPP22042)
ReferenceQi,C., (2002) J. Biol. Chem. 277 (32), 28624-28630
Publications

Arginine Methylation by PRMT2 Controls the Functions of the Actin Nucleator Cobl. Dev Cell. 45, 262-275.e8 (2018). 29689199

Burton, A. et al. Single-cell profiling of epigenetic modifiers identifies PRDM14 as an inducer of cell fate in the mammalian embryo. Cell Rep. 5, 687-701 (2013). 24183668

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Zhong, J. et al. Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma. FEBS J. 279, 316-35 (2012). 22093364

Zhong, J. et al. Identification and expression analysis of a novel transcript of the human PRMT2 gene resulted from alternative polyadenylation in breast cancer. Gene 487, 1-9 (2011). 21820040

Description
Gene SymbolPRMT2
Gene Full NameProtein arginine methyltransferase 2
Alias SymbolsHRMT1L1
NCBI Gene Id3275
Protein NameProtein arginine N-methyltransferase 2
Description of TargetThe protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.
Uniprot IDP55345
Protein Accession #NP_001526
Nucleotide Accession #NM_001535
Protein Size (# AA)433
Molecular Weight48kDa
Protein InteractionsFIP1L1; SPAG8; RIPK2; BAG6; RB1; HNRNPA1; E2F1; UBC; PSMB3; HHV8GK18_gp81; CPSF7; DMRTB1; HNRNPUL1; PRMT2; THRB; PGR; NCOA6; NCOA1; ESR2; RXRA; PRRC2A; ESR1; PPARG; RARA;
  1. What is the species homology for "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRMT2 Antibody - N-terminal region (ARP40196_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    This target may also be called "HRMT1L1" in publications.

  5. What is the shipping cost for "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRMT2 Antibody - N-terminal region (ARP40196_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRMT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRMT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRMT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRMT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRMT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRMT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRMT2 Antibody - N-terminal region (ARP40196_T100)
Your Rating
We found other products you might like!