- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
PRC1 Antibody (OAAN02101)
Datasheets/Manuals | Printable datasheet for anti-PRC1 (OAAN02101) |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IF, IHC |
:: | Positive Samples: MCF7, Jurkat, 293T, HepG2 Cellular Location: Cytoplasm, Midbody, Nucleus, cytoskeleton, spindle pole |
Reconstitution and Storage | Store at -20°C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant funsion protein containing a sequence corresponding to amino acids 351-620 of human PRC1 (NP_003972.1). |
Purification | Affinity purified against immunogen |
Peptide Sequence | LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASK |
Application Info | WB: 1:500~2000 IF: 1:50~200 IHC: 1:50~200 |
Publications | Upfront admixing antibodies and EGFR inhibitors preempts sequential treatments in lung cancer models. EMBO Mol Med. 13, e13144 (2021). 33660397 |
Description |
Gene Symbol | PRC1 |
---|---|
Gene Full Name | protein regulator of cytokinesis 1 |
Alias Symbols | ASE1 |
NCBI Gene Id | 9055 |
Protein Name | Protein regulator of cytokinesis 1 |
Description of Target | This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants. |
Uniprot ID | O43663 |
Protein Accession # | NP_001254509.1 |
Nucleotide Accession # | NM_001267580.1 |
Molecular Weight | 72 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PRC1 Antibody (OAAN02101)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "PRC1 Antibody (OAAN02101)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "PRC1 Antibody (OAAN02101)" provided in?
This item is provided in "Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PRC1 Antibody (OAAN02101)"?
This target may also be called "ASE1" in publications.
-
What is the shipping cost for "PRC1 Antibody (OAAN02101)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PRC1 Antibody (OAAN02101)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PRC1 Antibody (OAAN02101)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "72 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PRC1 Antibody (OAAN02101)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PRC1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PRC1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PRC1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PRC1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PRC1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PRC1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.