PPP1R8 Antibody - middle region (ARP40412_T100)

Catalog No: ARP40412_T100

WB Suggested Anti-PPP1R8 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

Rabbit Anti-PPP1R8 Antibody
Catalog Number: ARP40412
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP1R8
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
• Peptide Sequence: Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PPP1R8 (ARP40412_T100) antibody is Catalog # AAP40412 (Previous Catalog # AAPP22153)
• Specificity: This antibody recognizes isoform-gamma
• Reference: Lesage,B., (2004) J. Biol. Chem. 279 (53), 55978-55984

Target Info

• Gene Symbol: PPP1R8
• Gene Full Name: Protein phosphatase 1, regulatory subunit 8
• Alias Symbols: ARD1, ARD-1, NIPP1, NIPP-1, PRO2047
• NCBI Gene Id: 5511
• Protein Name: Nuclear inhibitor of protein phosphatase 1
• Description of Target: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
• Uniprot ID: Q12972
• Protein Accession #: NP_002704
• Nucleotide Accession #: NM_002713
• Protein Size (# AA): 127
• Molecular Weight: 14kDa
• Protein Interactions: APPBP2; UBC; FBXO25; HMGA1; WDR77; CTNNBL1; PPIL1; PPP1CC; PPP1CA; NF2; APP; SF3A2; Cep72; PPP1CB; SUZ12; RBBP4; EZH2; EED; RBM48; SF3B1; SETDB1; MELK; HDAC2; C14orf1; STC2; CDC5L; CRMP1; PRKACA; GBP2; LYN; CSNK2A2; CSNK2A1; NME2;