PPFIBP2 Antibody - C-terminal region (ARP67243_P050)

Catalog No: ARP67243_P050

WB Suggested Anti-PPFIBP2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPFIBP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PPFIBP2 (ARP67243_P050) antibody is Catalog # AAP67243

Target Info

• Gene Symbol: PPFIBP2
• Alias Symbols: Cclp1
• NCBI Gene Id: 8495
• Protein Name: Liprin-beta-2
• Description of Target: This gene encodes a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. The encoded protein is a beta liprin and plays a role in axon guidance and neuronal synapse development by recruiting LAR protein-tyrosine phosphatases to the plasma membrane. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q8ND30
• Protein Accession #: NP_003612
• Nucleotide Accession #: NM_003621
• Protein Size (# AA): 876
• Molecular Weight: 98kDa
• Protein Interactions: CRKL; CRK; APP; PRNP; PPFIA1; DTNB; PPFIA3; PPFIA2; TSG101; PTPRC; SFN;