POU4F2 Antibody - N-terminal region (ARP38501_P050)

Catalog No: ARP38501_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: POU4F2
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: POU4F2
Sample Tissue: Human OVCAR-3 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU4F2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POU4F2 (ARP38501_P050) antibody is Catalog # AAP38501 (Previous Catalog # AAPS04311)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Samady,L., (2006) Int. J. Cancer 118 (4), 869-878
• Publications:

  Tucker, B. A., Anfinson, K. R., Mullins, R. F., Stone, E. M. & Young, M. J. Use of a synthetic xeno-free culture substrate for induced pluripotent stem cell induction and retinal differentiation. Stem Cells Transl. Med. 2, 16-24 (2013). 23283489

Target Info

• Gene Symbol: POU4F2
• Gene Full Name: POU class 4 homeobox 2
• Alias Symbols: BRN3B, BRN3.2, Brn-3b
• NCBI Gene Id: 5458
• Protein Name: POU domain, class 4, transcription factor 2
• Description of Target: POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.POU4F2 is a member of the POU-domain family of transcription factors. POU-domain proteins have been observed to play important roles in control of cell identity in several systems. A class IV POU-domain protein, POU4F2 is found in human retina exclusively within a subpopulation of ganglion cells where it may play a role in determining or maintaining the identities of a small subset of visual system neurons.[supplied by OMIM].
• Uniprot ID: Q12837
• Protein Accession #: NP_004566
• Nucleotide Accession #: NM_004575
• Protein Size (# AA): 410
• Molecular Weight: 43 kDa
• Protein Interactions: ESR1;