SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48725_P050
Price: $0.00
SKU
ARP48725_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-POLR3A (ARP48725_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human POLR3A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 86%; Yeast: 85%
Peptide SequenceSynthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT
Concentration0.5 mg/ml
Blocking PeptideFor anti-POLR3A (ARP48725_P050) antibody is Catalog # AAP48725 (Previous Catalog # AAPP28774)
SubunitRPC1
ReferenceHu,P., (2002) Mol. Cell. Biol. 22 (22), 8044-8055
Gene SymbolPOLR3A
Gene Full NamePolymerase (RNA) III (DNA directed) polypeptide A, 155kDa
Alias SymbolsADDH, C160, HLD7, RPC1, WDRTS, RPC155, hRPC155
NCBI Gene Id11128
Protein NameDNA-directed RNA polymerase III subunit RPC1
Description of TargetDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.
Uniprot IDO14802
Protein Accession #NP_008986
Nucleotide Accession #NM_007055
Protein Size (# AA)1390
Molecular Weight156kDa
Protein InteractionsSUMO2; UBC; ASB13; NEDD4; POLR3H; VPS18; POLR3B; POLR1D; CRCP; POLR1A; POLR3C; POLR1C; SMARCA5; POLR2H; POLR2E; POLR3D; IKBKG; PCBD1; EWSR1; RPAP2; RPAP3; RPAP1; GPN1; RAE1; POLR3E; PKP2; GTF2B;
  1. What is the species homology for "POLR3A Antibody - middle region (ARP48725_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast".

  2. How long will it take to receive "POLR3A Antibody - middle region (ARP48725_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "POLR3A Antibody - middle region (ARP48725_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "POLR3A Antibody - middle region (ARP48725_P050)"?

    This target may also be called "ADDH, C160, HLD7, RPC1, WDRTS, RPC155, hRPC155" in publications.

  5. What is the shipping cost for "POLR3A Antibody - middle region (ARP48725_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "POLR3A Antibody - middle region (ARP48725_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "POLR3A Antibody - middle region (ARP48725_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "156kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "POLR3A Antibody - middle region (ARP48725_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "POLR3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "POLR3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "POLR3A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "POLR3A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "POLR3A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "POLR3A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:POLR3A Antibody - middle region (ARP48725_P050)
Your Rating
We found other products you might like!