POLE4 Antibody - N-terminal region (ARP39392_P050)

Catalog No: ARP39392_P050

WB Suggested Anti-POLE4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POLE4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Rat: 79%
• Peptide Sequence: Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POLE4 (ARP39392_P050) antibody is Catalog # AAP39392 (Previous Catalog # AAPP21407)
• Subunit: 4
• Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Publications:

  MicroRNA-7-regulated TLR9 signaling-enhanced growth and metastatic potential of human lung cancer cells by altering the phosphoinositide-3-kinase, regulatory subunit 3/Akt pathway. Mol Biol Cell. 24, 42-55 (2013). 23135998

• Description:
  View product citations for POLE4 Antibody - N-terminal region (ARP39392_P050) on CiteAb

Target Info

• Gene Symbol: POLE4
• Gene Full Name: Polymerase (DNA-directed), epsilon 4 (p12 subunit)
• Alias Symbols: p12, YHHQ1
• NCBI Gene Id: 56655
• Protein Name: DNA polymerase epsilon subunit 4
• Description of Target: POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
• Uniprot ID: Q9NR33
• Protein Accession #: NP_063949
• Nucleotide Accession #: NM_019896
• Protein Size (# AA): 117
• Molecular Weight: 12kDa
• Protein Interactions: NFYB; gag-pol; NUP133; POLE3; MAP3K7; UBC; YEATS2; POLE4; UBE3A; HSPA13; POLE2; POLE; RAD17;