POLDIP3 Antibody - C-terminal region (ARP41048_P050)

Catalog No: ARP41048_P050

Human Skin

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Human skin (formalin-fixed, paraffin-embedded) stained with POLDIP3 antibody ARP41048_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POLDIP3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POLDIP3 (ARP41048_P050) antibody is Catalog # AAP41048 (Previous Catalog # AAPP10646)
• Reference: Ma,X.M., (2008) Cell 133 (2), 303-313

Target Info

• Gene Symbol: POLDIP3
• Gene Full Name: Polymerase (DNA-directed), delta interacting protein 3
• Alias Symbols: SKAR, PDIP3, PDIP46
• NCBI Gene Id: 84271
• Protein Name: Polymerase delta-interacting protein 3
• Description of Target: POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.
• Uniprot ID: Q9BY77
• Protein Accession #: NP_115687
• Nucleotide Accession #: NM_032311
• Protein Size (# AA): 421
• Molecular Weight: 46kDa
• Protein Interactions: KRT40; LZTS2; BANP; MTUS2; PNMA1; RPS6KA1; NCBP1; GOLGA2; EIF4G1; EIF4A3; UBC; RNF2; PAN2; ERH; EIF4G2; NQO1; SIRT7; HDGF; POT1; TERF2; USP20; POLD2; RPS6KB1;