PIGK Antibody - N-terminal region (ARP40588_P050)

Catalog No: ARP40588_P050

WB Suggested Anti-PIGK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Pancreas

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIGK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
• Peptide Sequence: Synthetic peptide located within the following region: MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PIGK (ARP40588_P050) antibody is Catalog # AAP40588 (Previous Catalog # AAPP22764)
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Target Info

• Gene Symbol: PIGK
• Gene Full Name: Phosphatidylinositol glycan anchor biosynthesis, class K
• Alias Symbols: GPI8, NEDHCAS
• NCBI Gene Id: 10026
• Protein Name: GPI-anchor transamidase
• Description of Target: PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q92643
• Protein Accession #: NP_005473
• Nucleotide Accession #: NM_005482
• Protein Size (# AA): 395
• Molecular Weight: 43kDa
• Protein Interactions: FBXO6; UBC; PIGU; PIGS; PIGT; GPAA1; ALPP; ULBP2; CANX;