PHF6 Antibody - N-terminal region (ARP51237_T100)

Catalog No: ARP51237_T100

WB Suggested Anti-PHF6 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

Sample Type: HEK293T cells transfected with a plasmid for over expression of myc-tagged PHF6Primary Dilution: 1:1000Secondary (goat anti-rabbit HRP) Dilution: 1:1000

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHF6
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFH
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PHF6 (ARP51237_T100) antibody is Catalog # AAP51237 (Previous Catalog # AAPP28308)
• Reference: Vallee,D., (2004) J. Med. Genet. 41 (10), 778-783

Target Info

• Gene Symbol: PHF6
• Gene Full Name: PHD finger protein 6
• Alias Symbols: BFLS, BORJ, CENP-31
• NCBI Gene Id: 84295
• Protein Name: PHD finger protein 6
• Description of Target: PHF6 is a member of the plant homeodomain (PHD)-like finger (PHF) family. PHF6 is a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation that localizes to the nucleolus. Mutations affecting the coding region of its gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears.This gene is a member of the plant homeodomain (PHD)-like finger (PHF) family. It encodes a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation, that localizes to the nucleolus. Mutations affecting the coding region of this gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Uniprot ID: Q8IWS0
• Protein Accession #: NP_115834
• Nucleotide Accession #: NM_032458
• Protein Size (# AA): 365
• Molecular Weight: 41kDa
• Protein Interactions: UBC; SUMO1; NEDD8; BMI1; HECW2; CAND1; CUL3; HDGF;