SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54533_P050
Price: $0.00
SKU
ARP54533_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PELI3 Antibody - N-terminal region (ARP54533_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PELI3 (ARP54533_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PELI3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 77%; Pig: 100%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG
Concentration0.5 mg/ml
Blocking PeptideFor anti-PELI3 (ARP54533_P050) antibody is Catalog # AAP54533 (Previous Catalog # AAPP31317)
ReferenceButler,M.P., (2005) J. Biol. Chem. 280 (30), 27759-27768
Gene SymbolPELI3
Gene Full NamePellino E3 ubiquitin protein ligase family member 3
Alias SymbolsMGC35521
NCBI Gene Id246330
Protein NameE3 ubiquitin-protein ligase pellino homolog 3
Description of TargetToll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.Toll-like receptors (TLRs; see MIM 603030) and IL1R (IL1R1; MIM 147810) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R (Jensen and Whitehead, 2003 [PubMed 12874243]).[supplied by OMIM].
Uniprot IDQ8N2H9-2
Protein Accession #NP_001091980
Nucleotide Accession #NM_001098510
Protein Size (# AA)445
Molecular Weight48kDa
Protein InteractionsRIPK2; UBE2V1; UBE2N; IRAK1; APP; TRAF6; MAP3K14; MAP3K7; IRAK4; UBC; IRAK2;
  1. What is the species homology for "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PELI3 Antibody - N-terminal region (ARP54533_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    This target may also be called "MGC35521" in publications.

  5. What is the shipping cost for "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PELI3 Antibody - N-terminal region (ARP54533_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PELI3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PELI3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PELI3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PELI3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PELI3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PELI3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PELI3 Antibody - N-terminal region (ARP54533_P050)
Your Rating
We found other products you might like!