PDZK1 Antibody - N-terminal region (ARP41506_P050)

Catalog No: ARP41506_P050

WB Suggested Anti-PDZK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysatePDZK1 is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDZK1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PDZK1 (ARP41506_P050) antibody is Catalog # AAP41506 (Previous Catalog # AAPS09604)
• Sample Type Confirmation:

  PDZK1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: PDZK1
• Gene Full Name: PDZ domain containing 1
• Alias Symbols: CAP70, CLAMP, PDZD1, NHERF3, NHERF-3
• NCBI Gene Id: 5174
• Protein Name: Na(+)/H(+) exchange regulatory cofactor NHE-RF3
• Description of Target: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. PDZK1 may play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. PDZK1 may potentiate the CFTR chloride channel activity. It may function to connect SCARB1 with the cellular machineries for intracellular cholesterol transport and/or metabolism. PDZK1 may be involved in the regulation of proximal tubular Na+-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.
• Uniprot ID: Q5T2W1
• Protein Accession #: NP_002605
• Nucleotide Accession #: NM_002614
• Protein Size (# AA): 519
• Molecular Weight: 57kDa
• Protein Interactions: AKT1; CDC37; Ptgir; ABCC4; CFTR; APP; Klhl17; Syngap1; Dlg4; SLC26A6; SLC22A4; SLCO1A2; SLC15A2; PDZK1IP1; SLC22A11; SLC22A12; AKAP10; SLC22A5; ABCC2; SCARB1; CLCN3; PEX5; ABCA1; SSTR5; SLC17A1; SLC9A3; GFAP; SLC34A3; FARP2; SLK; SLC9A3R1; SLC9A3R2; UBE2I