PDPN Antibody - middle region (ARP44530_P050)

Catalog No: ARP44530_P050

WB Suggested Anti-PDPN Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDPN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PDPN (ARP44530_P050) antibody is Catalog # AAP44530 (Previous Catalog # AAPP12046)
• Reference: Christou,C.M., (2008) Biochem. J. 411 (1), 133-140

Target Info

• Gene Symbol: PDPN
• Gene Full Name: Podoplanin
• Alias Symbols: T1A, GP36, GP40, Gp38, OTS8, T1A2, TI1A, T1A-2, AGGRUS, HT1A-1, PA2.26
• NCBI Gene Id: 10630
• Protein Name: Podoplanin
• Description of Target: PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: Q86YL7-3
• Protein Accession #: NP_006465
• Nucleotide Accession #: NM_006474
• Protein Size (# AA): 238
• Molecular Weight: 25kDa
• Protein Interactions: TOM1L1;