SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100959_T100
Price: $0.00
SKU
P100959_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SUB1 (P100959_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PC4
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 91%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALS
Concentration1.0 mg/ml
Blocking PeptideFor anti-SUB1 (P100959_T100) antibody is Catalog # AAP31316 (Previous Catalog # AAPP02066)
Sample Type Confirmation

There is BioGPS gene expression data showing that SUB1 is expressed in Raji

ReferenceBanerjee,S., et al., (2004) Mol. Cell. Biol. 24 (5), 2052-2062
Description
Gene SymbolSUB1
Gene Full NameSUB1 homolog (S. cerevisiae)
Alias SymbolsP15, PC4, p14
NCBI Gene Id10923
Protein NameActivated RNA polymerase II transcriptional coactivator p15
Description of TargetPC4 is a transcriptional coactivator. General transcription factor IIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity rather than by reducing the repressive activity of PC4 via its phosphorylation
Uniprot IDP53999
Protein Accession #NP_006704
Nucleotide Accession #NM_006713
Protein Size (# AA)127
Molecular Weight14kDa
Protein InteractionsHUWE1; SUB1; UBC; rev; CLK4; CDK2; HNF4A; FN1; CSNK2A1; SMURF1; RPL18A; LAMP2; CDC5L; APP; YWHAZ; GTF3C1; ELAVL1; SUMO2; HDGF; Shoc2; Kif1c; POLR2B; POLR2A; CBX5; RCOR1; REST; BANF1; ADAP1; GTF2A1L; EP300; POU2AF1; CSTF2; TBP; TAF1; PCNA; HSF1; PSIP1; SP1
  1. What is the species homology for "PC4 Antibody - N-terminal region (P100959_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog".

  2. How long will it take to receive "PC4 Antibody - N-terminal region (P100959_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PC4 Antibody - N-terminal region (P100959_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PC4 Antibody - N-terminal region (P100959_T100)"?

    This target may also be called "P15, PC4, p14" in publications.

  5. What is the shipping cost for "PC4 Antibody - N-terminal region (P100959_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PC4 Antibody - N-terminal region (P100959_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PC4 Antibody - N-terminal region (P100959_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "14kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PC4 Antibody - N-terminal region (P100959_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SUB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SUB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SUB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SUB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SUB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SUB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PC4 Antibody - N-terminal region (P100959_T100)
Your Rating
We found other products you might like!