Catalog No: ARP32742_P050
Price: $0.00
SKU
ARP32742_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PAX7 (ARP32742_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of PAX7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT
Concentration0.5 mg/ml
Blocking PeptideFor anti-PAX7 (ARP32742_P050) antibody is Catalog # AAP32742
Publications

A collagen domain-derived short adiponectin peptide activates APPL1 and AMPK signaling pathways and improves glucose and fatty acid metabolisms. J Biol Chem. 293, 13509-13523 (2018). 29991592

CD163 interacts with TWEAK to regulate tissue regeneration after ischaemic injury. Nat Commun. 6, 7792 (2015). 26242746

Cell cycle regulation of embryonic stem cells and mouse embryonic fibroblasts lacking functional Pax7. Cell Cycle. 15, 2931-2942 (2016). 27610933

Cell-autonomous Notch activity maintains the temporal specification potential of skeletal muscle stem cells. Development. 139, 4536-48 (2012). 23136394

Early myogenic responses to acute exercise before and after resistance training in young men. Physiol Rep. 3, (2015). 26359239

Embryonic founders of adult muscle stem cells are primed by the determination gene Mrf4. Dev Biol. 381, 241-55 (2013). 23623977

First Neuromuscular Contact Correlates with Onset of Primary Myogenesis in Rat and Mouse Limb Muscles. PLoS One. 10, e0133811 (2015). 26207754

Klotho gene silencing promotes pathology in the mdx mouse model of Duchenne muscular dystrophy. Hum. Mol. Genet. 25, 2465-2482 (2016). 27154199

Laminin differentially regulates the stemness of type I and type II pericytes. Stem Cell Res Ther. 8, 28 (2017). 28173861

McDonald, A. A., Kunz, M. D. & McLoon, L. K. Dystrophic changes in extraocular muscles after gamma irradiation in mdx:utrophin(+/-) mice. PLoS One 9, e86424 (2014). 24466085

PAX3 Confers Functional Heterogeneity in Skeletal Muscle Stem Cell Responses to Environmental Stress. Cell Stem Cell. 24, 958-973.e9 (2019). 31006622

Pax7-expressing satellite cells are indispensable for adult skeletal muscle regeneration. Development. 138, 3647-56 (2011). 21828093

Sparing of the extraocular muscles in mdx mice with absent or reduced utrophin expression: A life span analysis. Neuromuscul. Disord. 25, 873-87 (2015). 26429098

The primary cilium dampens proliferative signaling and represses a G2/M transcriptional network in quiescent myoblasts. BMC Mol Cell Biol. 21, 25 (2020). 32293249

The role of Pitx2 and Pitx3 in muscle stem cells gives new insights into P38a MAP kinase and redox regulation of muscle regeneration. Elife. 7, (2018). 30106373

The transcription factor Lef1 switches partners from β-catenin to Smad3 during muscle stem cell quiescence. Sci Signal. 11, NULL (2018). 30042129

Description
Gene SymbolPAX7
Gene Full NamePaired box 7
Alias SymbolsHUP1, RMS2, PAX7B, MYOSCO
NCBI Gene Id5081
Protein NamePaired box protein Pax-7
Description of TargetPAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.
Uniprot IDP23759
Protein Accession #NP_002575
Nucleotide Accession #NM_002584
Protein Size (# AA)520
Molecular Weight57kDa
Protein InteractionsTRIM27; MYOD1; Dlg4; WDR5; ASH2L; HIRA; Ubc;
  1. What is the species homology for "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PAX7 Antibody - C-terminal region (ARP32742_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    This target may also be called "HUP1, RMS2, PAX7B, MYOSCO" in publications.

  5. What is the shipping cost for "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PAX7 Antibody - C-terminal region (ARP32742_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PAX7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PAX7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PAX7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PAX7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PAX7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PAX7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PAX7 Antibody - C-terminal region (ARP32742_P050)
Your Rating
We found other products you might like!