Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP49900_P050
Price: $0.00
SKU
ARP49900_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PAQR6 (ARP49900_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PAQR6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL
Concentration0.5 mg/ml
Blocking PeptideFor anti-PAQR6 (ARP49900_P050) antibody is Catalog # AAP49900 (Previous Catalog # AAPS27601)
Sample Type Confirmation

PAQR6 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceTang,Y.T., (2005) J. Mol. Evol. 61 (3), 372-380
Publications

Progestin-mediated activation of MAPK and AKT in nuclear progesterone receptor negative breast epithelial cells: The role of membrane progesterone receptors. Gene. 591, 6-13 (2016). 27349565

Gene SymbolPAQR6
Gene Full NameProgestin and adipoQ receptor family member VI
Alias SymbolsPRdelta
NCBI Gene Id79957
Protein NameProgestin and adipoQ receptor family member 6
Description of TargetThis protein mediates receptor activity
Uniprot IDQ5TCK9
Protein Accession #NP_079173
Nucleotide Accession #NM_024897
Protein Size (# AA)351
Molecular Weight39kDa
Protein InteractionsGLP1R;
  1. What is the species homology for "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PAQR6 Antibody - N-terminal region (ARP49900_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    This target may also be called "PRdelta" in publications.

  5. What is the shipping cost for "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PAQR6 Antibody - N-terminal region (ARP49900_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PAQR6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PAQR6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PAQR6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PAQR6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PAQR6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PAQR6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PAQR6 Antibody - N-terminal region (ARP49900_P050)
Your Rating
We found other products you might like!