PALM Antibody - N-terminal region (ARP56270_P050)

Catalog No: ARP56270_P050

WB Suggested Anti-PALM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Host: Rabbit
Target Name: NSUN6
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: PALM
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PALM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PALM (ARP56270_P050) antibody is Catalog # AAP56270 (Previous Catalog # AAPP44474)
• Publications:

  Konzer, A. et al. Stable isotope labeling in zebrafish allows in vivo monitoring of cardiac morphogenesis. Mol. Cell. Proteomics 12, 1502-12 (2013). 23412571

Target Info

• Gene Symbol: PALM
• Gene Full Name: Paralemmin
• Alias Symbols: PALM1
• NCBI Gene Id: 5064
• Protein Name: Paralemmin-1
• Description of Target: This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.
• Uniprot ID: O75781-2
• Protein Accession #: NP_001035224
• Nucleotide Accession #: NM_001040134
• Protein Size (# AA): 343
• Molecular Weight: 37kDa
• Protein Interactions: POT1; UBC;