P2RX4 Antibody - N-terminal region (ARP35512_P050)

Catalog No: ARP35512_P050

WB Suggested Anti-P2RX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-P2RX4 (ARP35512_P050) antibody is Catalog # AAP35512 (Previous Catalog # AAPP06752)
• Reference: An,W.F., (2007) Mol. Pharmacol. 72 (6), 1402-1405

Target Info

• Gene Symbol: P2RX4
• Gene Full Name: Purinergic receptor P2X, ligand-gated ion channel, 4
• Alias Symbols: P2X4, P2X4R
• NCBI Gene Id: 5025
• Protein Name: P2X purinoceptor 4
• Description of Target: P2RX4 is the receptor for ATP that acts as a ligand gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q99571
• Protein Accession #: NP_002551
• Nucleotide Accession #: NM_002560
• Protein Size (# AA): 388
• Molecular Weight: 43kDa
• Protein Interactions: NOTCH2NL; PIH1D3; KRTAP5-9; WNT4; MCM2; CDH5;