SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP51359_P050
Price: $0.00
SKU
ARP51359_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-OAS1 (ARP51359_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human OAS1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDG
Concentration0.5 mg/ml
Blocking PeptideFor anti-OAS1 (ARP51359_P050) antibody is Catalog # AAP51359 (Previous Catalog # AAPS23611)
Application InfoIHC - Paraffin ~~ 5 ug/ml
Western blot ~~1 ug/ml
Enhanced Validation
WBY
SPRY
YCHAROS
ReferencePhosri,C., Mycol. Res. 111 (PT 3), 275-286 (2007)
Publications

Yu, L. et al. Pattern recognition receptor-initiated innate antiviral response in mouse adipose cells. Immunol. Cell Biol. 92, 105-15 (2014). 24165978

Zhu, W. et al. RIG-I-like receptors mediate innate antiviral response in mouse testis. Mol. Endocrinol. 27, 1455-67 (2013). 23820901

Gene SymbolOAS1
Gene Full Name2'-5'-oligoadenylate synthetase 1, 40/46kDa
Alias SymbolsOIAS, IFI-4, OIASI, E18/E16
NCBI Gene Id4938
Protein Name2'-5'-oligoadenylate synthase 1
Description of TargetThis protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.
Uniprot IDP00973-3
Protein Accession #NP_001027581
Nucleotide Accession #NM_001032409
Protein Size (# AA)414
Molecular Weight46 kDa
Protein InteractionsEXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
  1. What is the species homology for "OAS1 Antibody - middle region (ARP51359_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "OAS1 Antibody - middle region (ARP51359_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OAS1 Antibody - middle region (ARP51359_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "OAS1 Antibody - middle region (ARP51359_P050)"?

    This target may also be called "OIAS, IFI-4, OIASI, E18/E16" in publications.

  5. What is the shipping cost for "OAS1 Antibody - middle region (ARP51359_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OAS1 Antibody - middle region (ARP51359_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OAS1 Antibody - middle region (ARP51359_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OAS1 Antibody - middle region (ARP51359_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OAS1 Antibody - middle region (ARP51359_P050)
Your Rating
We found other products you might like!