Catalog No: P101699_T100
Price: $0.00
SKU
P101699_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NUCB1 (P101699_T100) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityMouse, Rat, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 78%; Mouse: 92%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL
Concentration1.0 mg/ml
Blocking PeptideFor anti-NUCB1 (P101699_T100) antibody is Catalog # AAP32211 (Previous Catalog # AAPP03184)
ReferenceWendel,M., et al., 1995, J. Biol. Chem. 270 (11), 6125-6133
Publications

Lin, P. et al. Calnuc binds to Alzheimer’s beta-amyloid precursor protein and affects its biogenesis. J. Neurochem. 100, 1505-14 (2007). 17348862

Description
Gene SymbolNUCB1
Gene Full NameNucleobindin 1
Alias SymbolsNucb
NCBI Gene Id84595
Protein NameNucleobindin-1
Description of TargetAn extracellular calcium binding protein of the mineralized matrix of bone [Calnuc or RGD:620030]. Also useful as a Golgi marker in immunohistochemistry (1:100 dilution).
Uniprot IDQ63083
Protein Accession #NP_445915
Nucleotide Accession #NM_053463.1
Protein Size (# AA)459
Molecular Weight54kDa
Protein InteractionsSTXBP5L; GNAI3;
  1. What is the species homology for "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Mouse, Rat, Dog".

  2. How long will it take to receive "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NUCB1 Antibody - C-terminal region (P101699_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    This target may also be called "Nucb" in publications.

  5. What is the shipping cost for "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NUCB1 Antibody - C-terminal region (P101699_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NUCB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NUCB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NUCB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NUCB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NUCB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NUCB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NUCB1 Antibody - C-terminal region (P101699_T100)
Your Rating
We found other products you might like!