NSDHL Antibody - middle region (ARP47199_T100)

Catalog No: ARP47199_T100

WB Suggested Anti-NSDHL Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysateNSDHL is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NSDHL
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-NSDHL (ARP47199_T100) antibody is Catalog # AAP47199 (Previous Catalog # AAPP27971)
• Sample Type Confirmation:

  NSDHL is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Guggenberger,C., J. Steroid Biochem. Mol. Biol. 104 (3-5), 105-109 (2007)

Target Info

• Gene Symbol: NSDHL
• Gene Full Name: NAD(P) dependent steroid dehydrogenase-like
• Alias Symbols: H105E3, XAP104, SDR31E1
• NCBI Gene Id: 50814
• Protein Name: Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
• Description of Target: NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.The protein encoded by this gene is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in this gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males. Alternatively spliced transcript variants with differing 5' UTR have been found for this gene.
• Uniprot ID: Q15738
• Protein Accession #: NP_057006
• Nucleotide Accession #: NM_015922
• Protein Size (# AA): 373
• Molecular Weight: 42kDa
• Protein Interactions: UBC; FUS; SUMO3;