- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for NME2 Antibody (OAAL00218) |
---|
Predicted Species Reactivity | Human, Mouse, Rat |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 1E4 |
Isotype | IgG3 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | NME2 |
---|---|
Gene Full Name | NME/NM23 nucleoside diphosphate kinase 2 |
Alias Symbols | c-myc purine-binding transcription factor PUF;c-myc transcription factor;epididymis secretory sperm binding protein Li 155an;HEL-S-155an;histidine protein kinase NDKB;NDKB;NDP kinase B;NDPKB;NDPK-B;NM23B;NM23-H2;non-metastatic cells 2, protein (NM23) expressed in;non-metastatic cells 2, protein (NM23B) expressed in;nucleoside diphosphate kinase B;nucleotide diphosphate kinase B;PUF. |
NCBI Gene Id | 4831 |
Protein Name | Homo sapiens NME/NM23 nucleoside diphosphate kinase 2 (NME2), transcript variant 1, mRNA|nucleoside diphosphate kinase B isoform a [Homo sapiens] |
Description of Target | Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_002503 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_002512 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NME2 Antibody (OAAL00218)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".
-
How long will it take to receive "NME2 Antibody (OAAL00218)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "NME2 Antibody (OAAL00218)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NME2 Antibody (OAAL00218)"?
This target may also be called "c-myc purine-binding transcription factor PUF;c-myc transcription factor;epididymis secretory sperm binding protein Li 155an;HEL-S-155an;histidine protein kinase NDKB;NDKB;NDP kinase B;NDPKB;NDPK-B;NM23B;NM23-H2;non-metastatic cells 2, protein (NM23) expressed in;non-metastatic cells 2, protein (NM23B) expressed in;nucleoside diphosphate kinase B;nucleotide diphosphate kinase B;PUF." in publications.
-
What is the shipping cost for "NME2 Antibody (OAAL00218)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NME2 Antibody (OAAL00218)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NME2 Antibody (OAAL00218)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NME2 Antibody (OAAL00218)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NME2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NME2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NME2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NME2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NME2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NME2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.