- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for NKX2-5 Antibody (OAAL00063) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 3A7 |
Isotype | IgG2b Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | NKX2-5 (NP_004378, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNA* |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | NKX2-5 |
---|---|
Gene Full Name | NK2 homeobox 5 |
Alias Symbols | cardiac-specific homeobox 1;CHNG5;CSX;CSX1;HLHS2;homeobox protein CSX;homeobox protein NK-2 homolog E;homeobox protein NKX 2-5;homeobox protein Nkx-2.5;NK2 transcription factor related, locus 5;NKX 2-5;NKX2.5;NKX2E;NKX4-1;tinman homolog;tinman paralog;VSD3. |
NCBI Gene Id | 1482 |
Protein Name | homeobox protein Nkx-2.5 isoform 1 [Homo sapiens]|Homo sapiens NK2 homeobox 5 (NKX2-5), transcript variant 1, mRNA |
Description of Target | Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_004378 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_004387 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NKX2-5 Antibody (OAAL00063)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "NKX2-5 Antibody (OAAL00063)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "NKX2-5 Antibody (OAAL00063)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NKX2-5 Antibody (OAAL00063)"?
This target may also be called "cardiac-specific homeobox 1;CHNG5;CSX;CSX1;HLHS2;homeobox protein CSX;homeobox protein NK-2 homolog E;homeobox protein NKX 2-5;homeobox protein Nkx-2.5;NK2 transcription factor related, locus 5;NKX 2-5;NKX2.5;NKX2E;NKX4-1;tinman homolog;tinman paralog;VSD3." in publications.
-
What is the shipping cost for "NKX2-5 Antibody (OAAL00063)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NKX2-5 Antibody (OAAL00063)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NKX2-5 Antibody (OAAL00063)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NKX2-5 Antibody (OAAL00063)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NKX2-5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NKX2-5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NKX2-5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NKX2-5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NKX2-5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NKX2-5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.