NKIRAS1 Antibody - N-terminal region (ARP55370_P050)

Catalog No: ARP55370_P050

WB Suggested Anti-NKIRAS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NKIRAS1 (ARP55370_P050) antibody is Catalog # AAP55370 (Previous Catalog # AAPP33242)
• Reference: Adams,M.D., (er) Ann. Rheum. Dis. (2008) In press

Target Info

• Gene Symbol: NKIRAS1
• Gene Full Name: NFKB inhibitor interacting Ras-like 1
• Alias Symbols: KBRAS1, kappaB-Ras1
• NCBI Gene Id: 28512
• Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1
• Description of Target: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
• Uniprot ID: Q9NYS0
• Protein Accession #: NP_065078
• Nucleotide Accession #: NM_020345
• Protein Size (# AA): 192
• Molecular Weight: 22kDa
• Protein Interactions: XRCC2; UBC; APP; NFKBIB; SMURF2; BMPR1B; TGFBR1; NFKBIA; ACVR1;