Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP31177_P050
Price: $0.00
SKU
ARP31177_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFIL3 (ARP31177_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NFIL3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFIL3 (ARP31177_P050) antibody is Catalog # AAP31177 (Previous Catalog # AAPP24038)
ReferencePriceman,S.J., (2006) Biochem. Biophys. Res. Commun. 344 (2), 491-499
Gene SymbolNFIL3
Gene Full NameNuclear factor, interleukin 3 regulated
Alias SymbolsE4BP4, IL3BP1, NFIL3A, NF-IL3A
NCBI Gene Id4783
Protein NameNuclear factor interleukin-3-regulated protein
Description of TargetNFIL3 is a basic leucine zipper (bZIP) transcription factor that represses or activates transcription in non-osteoblastic cells. NFIL3 play a role in attenuation of PTH target gene transcription in osteoblasts. NFIL3 repression domain interacts specifically with the TBP binding repressor protein Dr1.Glucocorticoid-mediated upregulation of the bZIP transcriptional repressor gene, NFIL3, is dependent on [Ca2+]i levels, and correlates with Glucocorticoid-evoked apoptosis of Glucocorticoid-sensitive CEM-C7-14 cells. NFIL3 is involved in a distinct growth factor-regulated signaling pathway that is responsible for the survival of early B-cell progenitors, and whose alteration by E2A-HLF leads to childhood B lineage leukemia.
Uniprot IDQ16649
Protein Accession #NP_005375
Nucleotide Accession #NM_005384
Protein Size (# AA)462
Molecular Weight51kDa
Protein InteractionsAMOTL2; TRAF2; MAFF; BATF; NFIL3; MAFG; DDIT3; CBX8; SUMO2; UBC; CREB3; DR1;
  1. What is the species homology for "NFIL3 Antibody - middle region (ARP31177_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "NFIL3 Antibody - middle region (ARP31177_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFIL3 Antibody - middle region (ARP31177_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFIL3 Antibody - middle region (ARP31177_P050)"?

    This target may also be called "E4BP4, IL3BP1, NFIL3A, NF-IL3A" in publications.

  5. What is the shipping cost for "NFIL3 Antibody - middle region (ARP31177_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFIL3 Antibody - middle region (ARP31177_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFIL3 Antibody - middle region (ARP31177_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFIL3 Antibody - middle region (ARP31177_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFIL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFIL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFIL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFIL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFIL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFIL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFIL3 Antibody - middle region (ARP31177_P050)
Your Rating
We found other products you might like!