Catalog No: P100975_P050
Price: $0.00
SKU
P100975_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFATC3 (P100975_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NFATC3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFATC3 (P100975_P050) antibody is Catalog # AAP31016 (Previous Catalog # AAPP01749)
ReferenceManley,K., (2006) J. Virol. 80 (24), 12079-12085
Description
Gene SymbolNFATC3
Gene Full NameNuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
Alias SymbolsNFAT4, NFATX, NF-AT4c
NCBI Gene Id4775
Protein NameNuclear factor of activated T-cells c3 isoform IB-Xa EMBL ACG55625.1
Description of TargetNFATC3 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. NFATC3 plays a role in the regulation of gene expression in T cells and immature thymocytes.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene.
Uniprot IDB5B2S0
Protein Accession #NP_004546
Nucleotide Accession #NM_004555
Protein Size (# AA)1068
Molecular Weight115kDa
Protein InteractionsMAPK9; MAPK8; CDK6; NCOA3; TTF1; CSNK1A1; FOS;
  1. What is the species homology for "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse".

  2. How long will it take to receive "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFATC3 Antibody - N-terminal region (P100975_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    This target may also be called "NFAT4, NFATX, NF-AT4c" in publications.

  5. What is the shipping cost for "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "115kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFATC3 Antibody - N-terminal region (P100975_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFATC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFATC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFATC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFATC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFATC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFATC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFATC3 Antibody - N-terminal region (P100975_P050)
Your Rating
We found other products you might like!