website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

NEGR1 antibody - N-terminal region (ARP55701_P050)

Description of Target:
NEGR1 may be involved in cell-adhesion. NEGR1 may function as a trans-neural growth-promoting factor in regenerative axon sprouting in the mammalian brain.
Gene Symbol:
Official Gene Full Name:
Neuronal growth regulator 1
NCBI Gene Id:
Alias Symbols:
DMML2433; IGLON4; KILON; MGC46680; Ntra
Tissue Tool:
Find tissues and cell lines supported to express NEGR1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Neuronal growth regulator 1
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
NEGR1 antibody - N-terminal region (ARP55701_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Mouse, Human, Pig, Rat, Dog, Horse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-NEGR1 antibody
- ARP55701_P050
Peptide Sequence:
Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
Blocking Peptide:
For anti-NEGR1 antibody is Catalog # AAP55701 (Previous Catalog # AAPP44438)
Key Reference:
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-NEGR1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question