NDP Antibody - middle region (ARP56082_P050)

Catalog No: ARP56082_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-NDP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-NDP antibody (ARP56082_P050)

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NDP (ARP56082_P050) antibody is Catalog # AAP56082 (Previous Catalog # AAPP37547)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Khan,A.O., (2008) Ophthalmology 115 (4), 730-733

Target Info

• Gene Symbol: NDP
• Gene Full Name: Norrie disease (pseudoglioma)
• Alias Symbols: ND, EVR2, FEVR
• NCBI Gene Id: 4693
• Protein Name: Norrin
• Description of Target: NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). NDP may be involved in a pathway that regulates neural cell differentiation and proliferation. NDP is the genetic locus identified as harboring mutations that result in Norrie disease. Norrie disease is a rare genetic disorder characterized by bilateral congenital blindness that is caused by a vascularized mass behind each lens due to a maldeveloped retina (pseudoglioma). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 AL034370.1 53727-53820 c 95-1761 X65882.1 1-1667 1762-1935 BE139596.1 1-174 c
• Uniprot ID: Q00604
• Protein Accession #: NP_000257
• Nucleotide Accession #: NM_000266
• Protein Size (# AA): 133
• Molecular Weight: 15kDa
• Protein Interactions: FZD4; NDP; BAG3; APP; LGALS8; PPP1CA;