website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

N6AMT1 antibody - N-terminal region (ARP45845_P050)

Description of Target:
The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Gene Symbol:
Official Gene Full Name:
N-6 adenine-specific DNA methyltransferase 1 (putative)
NCBI Gene Id:
Alias Symbols:
C21orf127; HEMK2; MGC19995; MTQ2; N6AMT; PRED28
Sample Type Confirmation:

N6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226

Tissue Tool:
Find tissues and cell lines supported to express N6AMT1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
HemK methyltransferase family member 2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
SUP45; SUP35;
The immunogen for anti-N6AMT1 antibody: synthetic peptide directed towards the N terminal of human N6AMT1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
N6AMT1 antibody - N-terminal region (ARP45845_P050)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Pig: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%
Species Reactivity:
Human, Rat, Horse, Bovine, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-N6AMT1 antibody
- ARP45845_P050
Peptide Sequence:
Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
Blocking Peptide:
For anti-N6AMT1 antibody is Catalog # AAP45845 (Previous Catalog # AAPS17007)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for N6AMT1 antibody (ARP45845)

Product page for N6AMT1 antibody (ARP45845)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100655640 antibody; Loxodonta africana LOC100655640 antibody G3SNK8 100%
Bovine N6AMT1 antibody; Bos taurus N6AMT1 antibody A4FV35 92%
Dog N6AMT1 antibody; Canis familiaris N6AMT1 antibody E2R9Q5 92%
Dog N6AMT1 antibody; Canis familiaris N6AMT1 antibody E2QSE4 92%
Giant panda LOC100464667 antibody; Ailuropoda melanoleuca LOC100464667 antibody D2HGA9 92%
Guinea pig LOC100714564 antibody; Cavia porcellus LOC100714564 antibody H0V123 92%
Horse N6AMT1 antibody; Equus caballus N6AMT1 antibody F6YDD7 100%
Human HEMK2 antibody; Homo sapiens HEMK2 antibody Q9Y5N5 100%
Human HEMK2 antibody; Homo sapiens HEMK2 antibody Q9Y5N5-2 100%
Human HEMK2 antibody; Homo sapiens HEMK2 antibody B2RA97 100%
Lowland gorilla N6AMT1 antibody; Gorilla gorilla gorilla N6AMT1 antibody G3SK75 100%
Mouse N6amt1 antibody; Mus musculus N6amt1 antibody Q6SKR2 92%
Mouse N6amt1 antibody; Mus musculus N6amt1 antibody Q6PRU9 92%
Mouse N6amt1 antibody; Mus musculus N6amt1 antibody Q4KMV5 92%
Mouse N6amt1 antibody; Mus musculus N6amt1 antibody E9PXT7 92%
Mouse N6amt1 antibody; Mus musculus N6amt1 antibody D3Z6J0 92%
Northern white-cheeked gibbon LOC100590958 antibody; Nomascus leucogenys LOC100590958 antibody G1QRA3 100%
Rabbit LOC100352597 antibody; Oryctolagus cuniculus LOC100352597 antibody G1SEP9 92%
Rat N6amt1 antibody; Rattus norvegicus N6amt1 antibody D4ACA2 100%
Rhesus macaque N6AMT1 antibody; Macaca mulatta N6AMT1 antibody F6SE63 100%
Rhesus macaque N6AMT1 antibody; Macaca mulatta N6AMT1 antibody F6SDL4 100%
Small-eared galago N6AMT1 antibody; Otolemur garnettii N6AMT1 antibody H0XZY6 85%
Small-eared galago N6AMT1 antibody; Otolemur garnettii N6AMT1 antibody H0X4G1 85%
Spotted green pufferfish MT antibody; Tetraodon nigroviridis MT antibody Q800G0 83%
Spotted green pufferfish mt antibody; Tetraodon nigroviridis mt antibody Q800F5 83%
White-tufted-ear marmoset LOC100413532 antibody; Callithrix jacchus LOC100413532 antibody F7HFC3 92%
White-tufted-ear marmoset LOC100413532 antibody; Callithrix jacchus LOC100413532 antibody F7GZW1 92%

Product Protocols: N6AMT1 antibody tested with Human Nci-H226 Cells (ARP45845_P050)

Aviva Systems Biology is the original manufacturer of this N6AMT1 antibody (ARP45845_P050)

Click here to view the N6AMT1 antibody Western Blot Protocol

Product Datasheet Link: N6AMT1 antibody (ARP45845_P050)

WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NCI-H226

Western Blot image:

Description of Target: The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s N6AMT1 antibody (ARP45845_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question