website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

N6AMT1 antibody - N-terminal region (ARP45845_P050)

Description of Target:
The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Gene Symbol:
Official Gene Full Name:
N-6 adenine-specific DNA methyltransferase 1 (putative)
NCBI Gene Id:
Alias Symbols:
C21orf127; HEMK2; MGC19995; MTQ2; N6AMT; PRED28
Sample Type Confirmation:

N6AMT1 is supported by BioGPS gene expression data to be expressed in NCIH226

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express N6AMT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express N6AMT1.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
HemK methyltransferase family member 2
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
SUP45; SUP35;
The immunogen is a synthetic peptide directed towards the N terminal region of human N6AMT1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-N6AMT1 (ARP45845_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
Species Reactivity:
Cow; Guinea Pig; Horse; Human; Mouse; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-N6AMT1 (ARP45845_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
Blocking Peptide:
For anti-N6AMT1 (ARP45845_P050) antibody is Catalog # AAP45845 (Previous Catalog # AAPS17007)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: N6AMT1 antibody tested with Human Nci-H226 Cells (ARP45845_P050)

Aviva Systems Biology is the original manufacturer of this N6AMT1 antibody (ARP45845_P050)

Click here to view the N6AMT1 antibody Western Blot Protocol

Product Datasheet Link: N6AMT1 antibody (ARP45845_P050)

WB Suggested Anti-N6AMT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: NCI-H226

Western Blot image:

Description of Target: The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s N6AMT1 antibody (ARP45845_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question