SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP32708_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP32708_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-MYC (ARP32708_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MYC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Peptide SequenceSynthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MYC (ARP32708_P050-Biotin) antibody is Catalog # AAP32708 (Previous Catalog # AAPP03722)
ReferenceFrater,J.L., (2006) Cancer Genet. Cytogenet. 166 (2), 139-145
Gene SymbolMYC
Gene Full NameV-myc myelocytomatosis viral oncogene homolog (avian)
Alias SymbolsMRTL, MYCC, c-Myc, bHLHe39
NCBI Gene Id4609
Protein NameMyc proto-oncogene protein
Description of TargetMYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
Uniprot IDP01106
Protein Accession #NP_002458
Nucleotide Accession #NM_002467
Protein Size (# AA)454
Molecular Weight50kDa
Protein InteractionsUBC; USP37; USP22; KDM1A; SKP2; SMAD7; SNRNP70; CEP57; LDOC1; BRD3; KIDINS220; MAX; CSNK2B; CSNK2A1; USP28; NMI; PFDN5; TP73; EP400; SP1; PIAS2; ZBTB17; IGF2BP3; PTRF; SDK1; MRPL53; PRKCDBP; PHLDB2; KNDC1; MZT2B; RIN3; NEK11; MICALL2; NLRX1; NABP2; MYC; M
  1. What is the species homology for "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    This target may also be called "MRTL, MYCC, c-Myc, bHLHe39" in publications.

  5. What is the shipping cost for "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MYC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MYC Antibody - N-terminal region : Biotin (ARP32708_P050-Biotin)
Your Rating
We found other products you might like!