MUC12 Antibody - middle region (ARP45581_P050)

Catalog No: ARP45581_P050

WB Suggested Anti-MUC12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MUC12
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MUC12 (ARP45581_P050) antibody is Catalog # AAP45581 (Previous Catalog # AAPS16010)

Target Info

• Gene Symbol: MUC12
• Gene Full Name: Mucin 12, cell surface associated
• Alias Symbols: MUC11, MUC-11, MUC-12
• NCBI Gene Id: 10071
• Description of Target: MUC12 is involved in epithelial cell protection, adhesion modulation, and signaling. It may be involved in epithelial cell growth regulation. The protein is stimulated by both cytokine TNF-alpha and TGF-beta in intestinal epithelium.
• Uniprot ID: Q9UKN1
• Protein Accession #: XP_499351
• Nucleotide Accession #: XM_499351
• Protein Size (# AA): 748
• Molecular Weight: 81kDa
• Protein Interactions: MAPK14; CDC42;