MTTP Antibody - N-terminal region (ARP43618_P050)

Catalog No: ARP43618_P050

Host: Rabbit
Target Name: MTTP
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTTP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MTTP (ARP43618_P050) antibody is Catalog # AAP43618 (Previous Catalog # AAPS15812)
• Sample Type Confirmation:

  MTTP is supported by BioGPS gene expression data to be expressed in HepG2

• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Reference: Lundahl,B., Am. J. Physiol. Endocrinol. Metab. 290 (4), E739-E745 (2006)
• Publications:

  Cardiomyocyte Regulation of Systemic Lipid Metabolism by the Apolipoprotein B-Containing Lipoproteins in Drosophila. PLoS Genet. 13, e1006555 (2017). 28095410

  In Vitro effect of DDE exposure on the regulation of lipid metabolism and secretion in McA-RH7777 hepatocytes: A potential role in dyslipidemia which may increase the risk of type 2 diabetes mellitus. Toxicol In Vitro. 37, 9-14 (2016). 27565303

Target Info

• Gene Symbol: MTTP
• Gene Full Name: Microsomal triglyceride transfer protein
• Alias Symbols: ABL, MTP
• NCBI Gene Id: 4547
• Protein Name: Microsomal triglyceride transfer protein large subunit
• Description of Target: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.
• Uniprot ID: P55157
• Protein Accession #: NP_000244
• Nucleotide Accession #: NM_000253
• Protein Size (# AA): 894
• Molecular Weight: 99 kDa
• Protein Interactions: HSP90B1; APOB;