Catalog No: ARP62688_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP62688_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-MRPL3 (ARP62688_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: MPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFR
Concentration0.5 mg/ml
Blocking PeptideFor anti-MRPL3 (ARP62688_P050-FITC) antibody is Catalog # AAP62688
Gene SymbolMRPL3
Gene Full NameMitochondrial ribosomal protein L3
Alias SymbolsMRL3, RPML3, COXPD9
NCBI Gene Id11222
Protein Name39S ribosomal protein L3, mitochondrial
Description of TargetMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.
Uniprot IDP09001
Protein Accession #NP_009139
Nucleotide Accession #NM_007208
Protein Size (# AA)348
Molecular Weight38kDa
Protein InteractionsUBC; MRPS27; mug82; ICT1; C1QBP; MRPL55; MRPL10; MRPL52; MRPL9; MRPL41; MRPS9; MRPL17; MRPL39; MRPL4; MRPL13; MRPL42; MRPL46; MRPL19; RPS18; RPS15; MRPL12; MRPL23; NDUFS3; APP; CAND1;
  1. What is the species homology for "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    This target may also be called "MRL3, RPML3, COXPD9" in publications.

  5. What is the shipping cost for "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MRPL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRPL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRPL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRPL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRPL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRPL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRPL3 Antibody - N-terminal region : FITC (ARP62688_P050-FITC)
Your Rating
We found other products you might like!