website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

MRPL13 antibody - middle region (ARP54978_P050)

Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.
Gene Symbol:
MRPL13
Official Gene Full Name:
Mitochondrial ribosomal protein L13
NCBI Gene Id:
28998
Alias Symbols:
L13; L13mt; RPL13; RPML13; L13A
Sample Type Confirmation:

MRPL13 is supported by BioGPS gene expression data to be expressed in 721_B

Tissue Tool:
Find tissues and cell lines supported to express MRPL13.
Protein Accession #:
NP_054797
Nucleotide Accession#:
NM_014078
Swissprot Id:
Q9BYD1
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
39S ribosomal protein L13, mitochondrial
Protein Size (# AA):
178
Molecular Weight:
21kDa
Application:
WB
Immunogen:
The immunogen for anti-MRPL13 antibody: synthetic peptide directed towards the middle region of human MRPL13
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
MRPL13 antibody - middle region (ARP54978_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 79%
Species Reactivity:
Human, Pig, Horse, Mouse, Rat, Dog, Zebrafish, Rabbit, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MRPL13 antibody
- ARP54978_P050
Peptide Sequence:
Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD
Blocking Peptide:
For anti-MRPL13 antibody is Catalog # AAP54978 (Previous Catalog # AAPP32139)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MRPL13 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for MRPL13 antibody (ARP54978)

Product page for MRPL13 antibody (ARP54978)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant MRPL13 antibody; Loxodonta africana MRPL13 antibody G3TAG3 100%
Atlantic salmon RM13 antibody; Salmo salar RM13 antibody B5XDY3 85%
Atlantic salmon RM13 antibody; Salmo salar RM13 antibody B5XC86 85%
Bovine RM13 antibody; Bos taurus RM13 antibody Q3SYS1 92%
Channel catfish rm13 antibody; Ictalurus punctatus rm13 antibody E3TG76 85%
Dog MRPL13 antibody; Canis familiaris MRPL13 antibody E2RT81 92%
Duckbill platypus MRPL13 antibody; Ornithorhynchus anatinus MRPL13 antibody F7G4S2 92%
Duckbill platypus MRPL13 antibody; Ornithorhynchus anatinus MRPL13 antibody F7G4R8 92%
Giant panda LOC100467008 antibody; Ailuropoda melanoleuca LOC100467008 antibody G1L619 85%
Gray short-tailed opossum LOC100031909 antibody; Monodelphis domestica LOC100031909 antibody F6YE65 100%
Guinea pig MRPL13 antibody; Cavia porcellus MRPL13 antibody H0V6B0 78%
Horse LOC100066471 antibody; Equus caballus LOC100066471 antibody F6U4D0 100%
Human MRPL13 antibody; Homo sapiens MRPL13 antibody H0YAX3 100%
Human MRPL13 antibody; Homo sapiens MRPL13 antibody E5RJI7 100%
Human RM13 antibody; Homo sapiens RM13 antibody Q9BYD1 100%
Little brown bat MRPL13 antibody; Myotis lucifugus MRPL13 antibody G1PEF1 100%
Lowland gorilla MRPL13 antibody; Gorilla gorilla gorilla MRPL13 antibody G3S540 100%
Mouse Mrpl13 antibody; Mus musculus Mrpl13 antibody Q7TMH5 100%
Mouse Mrpl13 antibody; Mus musculus Mrpl13 antibody Q05CB9 100%
Mouse Mrpl13 antibody; Mus musculus Mrpl13 antibody F7CXG9 100%
Mouse RM13 antibody; Mus musculus RM13 antibody Q9D1P0 100%
Northern pike RM13 antibody; Esox lucius RM13 antibody C1BX06 85%
Northern white-cheeked gibbon LOC100602004 antibody; Nomascus leucogenys LOC100602004 antibody G1QZ38 100%
Pig MRPL13 antibody; Sus scrofa MRPL13 antibody F1S286 100%
Rabbit LOC100354016 antibody; Oryctolagus cuniculus LOC100354016 antibody G1TB33 92%
Rabbit MRPL13 antibody; Oryctolagus cuniculus MRPL13 antibody G1TIR6 92%
Rainbow smelt RM13 antibody; Osmerus mordax RM13 antibody C1BLH0 85%
Rat Mrpl13 antibody; Rattus norvegicus Mrpl13 antibody Q5XFW4 100%
Rhesus macaque MRPL13 antibody; Macaca mulatta MRPL13 antibody F7HQC8 100%
Sablefish RM13 antibody; Anoplopoma fimbria RM13 antibody C3KJ56 85%
Small-eared galago MRPL13 antibody; Otolemur garnettii MRPL13 antibody H0XAX2 100%
White-tufted-ear marmoset LOC100403753 antibody; Callithrix jacchus LOC100403753 antibody F7GRV5 100%
White-tufted-ear marmoset LOC100403753 antibody; Callithrix jacchus LOC100403753 antibody F6S6K9 100%
White-tufted-ear marmoset LOC100404854 antibody; Callithrix jacchus LOC100404854 antibody F7IM64 100%
Zebrafish mrpl13 antibody; Danio rerio mrpl13 antibody Q504D1 92%
Zebrafish mrpl13 antibody; Danio rerio mrpl13 antibody F1QQ34 92%

Product Protocols: MRPL13 antibody tested with Human 721_B_Lymphoblast (ARP54978_P050)

Aviva Systems Biology is the original manufacturer of this MRPL13 antibody (ARP54978_P050)

Click here to view the MRPL13 antibody Western Blot Protocol

Product Datasheet Link: MRPL13 antibody (ARP54978_P050)

WB Suggested Anti-MRPL13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B

Western Blot image:


Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MRPL13 antibody (ARP54978_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question