website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

MOS antibody - middle region (ARP56631_P050)

Description of Target:
MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).
Gene Symbol:
MOS
Official Gene Full Name:
V-mos Moloney murine sarcoma viral oncogene homolog
NCBI Gene Id:
4342
Alias Symbols:
MGC119962; MGC119963; MSV
Sample Type Confirmation:

MOS is supported by BioGPS gene expression data to be expressed in NCIH226

Tissue Tool:
Find tissues and cell lines supported to express MOS.
Protein Accession #:
NP_005363
Nucleotide Accession#:
NM_005372
Swissprot Id:
P00540
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Proto-oncogene serine/threonine-protein kinase mos
Protein Size (# AA):
346
Molecular Weight:
38kDa
Application:
WB
Partner Proteins:
DLG1
Immunogen:
The immunogen for anti-MOS antibody: synthetic peptide directed towards the middle region of human MOS
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
MOS antibody - middle region (ARP56631_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 92%; Guinea pig: 86%
Species Reactivity:
Mouse, Dog, Rat, Human, Pig, Rabbit, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MOS antibody
- ARP56631_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
Blocking Peptide:
For anti-MOS antibody is Catalog # AAP56631 (Previous Catalog # AAPP39336)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MOS antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for MOS antibody (ARP56631)

Product page for MOS antibody (ARP56631)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Aardvark c-mos antibody; Orycteropus afer c-mos antibody Q2TVE8 92%
Acanthisitta chloris c-mos antibody Q8QH82 81%
Admiralty flying fox c-mos antibody; Pteropus admiralitatum c-mos antibody Q8MIW0 100%
Admiralty flying fox c-mos antibody; Pteropus admiralitatum c-mos antibody Q8MIV9 100%
Aegithalos iouschensis c-mos antibody Q8QH81 81%
African black-headed oriole c-mos antibody; Oriolus larvatus c-mos antibody Q8QH45 81%
African elephant LOC100653879 antibody; Loxodonta africana LOC100653879 antibody G3SXP8 85%
African long-tongued fruit bat c-mos antibody; Megaloglossus woermanni c-mos antibody Q8MIX3 100%
African spoonbill c-mos antibody; Platalea alba c-mos antibody Q90XW0 81%
Alectoris chukar falki c-mos antibody D8WN10 90%
Alectoris chukar potanini c-mos antibody D8WN11 90%
Alectoris chukar pubescens c-mos antibody D8WN13 90%
Andean condor MOS antibody; Vultur gryphus MOS antibody Q90XV7 81%
Arabian common dolphin c-mos antibody; Delphinus tropicalis c-mos antibody Q6Y654 92%
Atlantic bottle-nosed dolphin c-mos antibody; Tursiops truncatus c-mos antibody Q6Y649 92%
Bananaquit c-mos antibody; Coereba flaveola c-mos antibody Q9I9F6 81%
banded Pitta c-mos antibody; Pitta guajana c-mos antibody Q8QH34 81%
Barred cuckooshrike c-mos antibody; Coracina lineata c-mos antibody Q8QH68 81%
Black stork MOS antibody; Ciconia nigra MOS antibody Q90XV8 81%
Black-bellied fruit bat c-mos antibody; Melonycteris melanops c-mos antibody Q8MHZ6 100%
Black-capped fruit bat c-mos antibody; Chironax melanocephalus c-mos antibody Q8MIX1 100%
Black-capped fruit bat c-mos antibody; Chironax melanocephalus c-mos antibody Q8MIX0 100%
Black-crowned night-heron MOS antibody; Nycticorax nycticorax MOS antibody Q90XV9 81%
black-faced antthrush c-mos antibody; Formicarius analis c-mos antibody Q9I9G3 81%
Blainville beaked whale c-mos antibody; Mesoplodon densirostris c-mos antibody Q1XAH0 92%
Blue-footed booby c-mos antibody; Sula nebouxii c-mos antibody Q90XV5 81%
Blue-winged leafbird c-mos antibody; Chloropsis cochinchinensis c-mos antibody Q8QH73 81%
Bohemian waxwing c-mos antibody; Bombycilla garrulus c-mos antibody Q8QH76 81%
Bovine C-MOS antibody; Bos taurus C-MOS antibody F6RCH9 92%
Bovine MOS antibody; Bos taurus MOS antibody Q6GW11 92%
Bovine MOS antibody; Bos taurus MOS antibody Q2TVF3 92%
Brambling c-mos antibody; Fringilla montifringilla c-mos antibody Q8QH62 81%
Brown jay c-mos antibody; Cyanocorax morio c-mos antibody Q9I9G1 81%
Brown kiwi MOS antibody; Apteryx australis MOS antibody P87347 81%
Brown pelican c-mos antibody; Pelecanus occidentalis c-mos antibody Q90XW1 81%
brown trembler c-mos antibody; Cinclocerthia ruficauda c-mos antibody Q9I9G0 81%
Bulmer fruit bat c-mos antibody; Aproteles bulmerae c-mos antibody Q8MIW2 100%
Cacomantis pyrrhophanus c-mos antibody Q9PUP4 81%
California condor MOS antibody; Gymnogyps californianus MOS antibody Q90XV6 81%
Caribbean manatee c-mos antibody; Trichechus manatus c-mos antibody Q2TVE9 92%
Carrion crow c-mos antibody; Corvus corone c-mos antibody Q8QH67 81%
Ceram flying fox c-mos antibody; Pteropus ocularis c-mos antibody Q8MIV1 100%
Chalcites lucidus c-mos antibody Q9PUP5 81%
Chicken c-mos antibody; Gallus gallus c-mos antibody D8WN45 90%
Chicken MOS antibody; Gallus gallus MOS antibody P10741 90%
Chicken MOS antibody; Gallus gallus MOS antibody Q8QH60 90%
Chicken MOS antibody; Gallus gallus MOS antibody F1NUS1 90%
Chicken MOS antibody; Gallus gallus MOS antibody F1NAP4 90%
Chimney swift c-mos antibody; Chaetura pelagica c-mos antibody Q9PUP9 81%
Chinese bamboo-partridge c-mos antibody; Bambusicola thoracicus c-mos antibody D8WN46 90%
Chowchilla c-mos antibody; Orthonyx spaldingii c-mos antibody Q8QH44 81%
Cisticola anonymus c-mos antibody Q8QH71 81%
Cliff swallow c-mos antibody; Petrochelidon pyrrhonota c-mos antibody Q8QH58 81%
Common iora c-mos antibody; Aegithina tiphia c-mos antibody Q8QH80 81%
Common nighthawk c-mos antibody; Chordeiles minor c-mos antibody Q9PUP7 81%
Common rousette c-mos antibody; Rousettus amplexicaudatus c-mos antibody Q8MIX2 100%
Common tube-nosed fruit bat c-mos antibody; Nyctimene albiventer c-mos antibody Q8MIY9 100%
Dall porpoise c-mos antibody; Phocoenoides dalli c-mos antibody Q6Y644 92%
Dendroica adelaidae c-mos antibody Q9I9F8 81%
Dog MOS antibody; Canis familiaris MOS antibody F1PN64 100%
Domestic duck c-mos antibody; Anas platyrhynchos c-mos antibody Q90XU7 81%
Dwarf flying fox c-mos antibody; Pteropus woodfordi c-mos antibody Q8MIU2 92%
Eastern tube-nosed bat c-mos antibody; Nyctimene robinsoni c-mos antibody Q8MIY5 100%
Eurasian common shrew c-mos antibody; Sorex araneus c-mos antibody Q2TVF1 92%
Eurasian skylark c-mos antibody; Alauda arvensis c-mos antibody Q8QH79 81%
Eurasian treecreeper c-mos antibody; Certhia familiaris c-mos antibody Q8QH74 81%
Fardoulis blossum-bat c-mos antibody; Melonycteris fardoulisi c-mos antibody Q8MIY0 100%
Finless porpoise c-mos antibody; Neophocaena phocaenoides c-mos antibody Q6Y655 92%
Formicarius colma c-mos antibody Q8QH63 81%
Franciscana c-mos antibody; Pontoporia blainvillei c-mos antibody Q6Y651 92%
Franquet epauleted fruit bat c-mos antibody; Epomops franqueti c-mos antibody Q8MIX5 100%
Furnarius rufus c-mos antibody Q8QH61 81%
Ganges river dolphin c-mos antibody; Platanista gangetica c-mos antibody Q6Y652 92%
Garrulax milleti c-mos antibody Q8QH59 81%
Golden-crowned warbler c-mos antibody; Basileuterus culicivorus c-mos antibody Q9I9F7 81%
Gray seal c-mos antibody; Halichoerus grypus c-mos antibody Q2TVE7 92%
Great blue turaco c-mos antibody; Corythaeola cristata c-mos antibody Q9PUN7 81%
Great cormorant c-mos antibody; Phalacrocorax carbo c-mos antibody Q90XV4 81%
Great flying fox c-mos antibody; Pteropus neohibernicus c-mos antibody Q8MIV3 92%
Great horned owl c-mos antibody; Bubo virginianus c-mos antibody Q9PUP8 81%
Greater flamingo c-mos antibody; Phoenicopterus ruber c-mos antibody Q90XV0 81%
Green monkey MOS antibody; Chlorocebus aethiops MOS antibody P10650 100%
Greenish naked-backed fruit bat c-mos antibody; Dobsonia viridis c-mos antibody Q8MIW3 100%
Grey go-away-bird c-mos antibody; Corythaixoides concolor c-mos antibody Q9PUN6 81%
Grey wagtail c-mos antibody; Motacilla cinerea c-mos antibody Q8QH49 81%
Guadalcanal monkey-faced bat c-mos antibody; Pteralopex atrata c-mos antibody Q8MIW1 100%
Guinea pig MOS antibody; Cavia porcellus MOS antibody H0W054 85%
Guira cuckoo c-mos antibody; Guira guira c-mos antibody Q9PUP1 81%
Hammerkop c-mos antibody; Scopus umbretta c-mos antibody Q90XW3 81%
Harbor porpoise c-mos antibody; Phocoenoides phocoena c-mos antibody Q6Y645 92%
Helmeted guineafowl c-mos antibody; Numida meleagris c-mos antibody P87364 90%
Hoatzin c-mos antibody; Opisthocomus hoazin c-mos antibody Q9PUN5 81%
Horned grebe c-mos antibody; Podiceps auritus c-mos antibody Q90XV2 81%
Human MOS antibody; Homo sapiens MOS antibody P00540 100%
Indian short-nosed fruit bat c-mos antibody; Cynopterus sphinx c-mos antibody Q2TVF2 92%
Indo-pacific bottle-nosed dolphin c-mos antibody; Tursiops aduncus c-mos antibody Q6Y648 92%
Indo-pacific humpbacked dolphin c-mos antibody; Sousa chinensis c-mos antibody Q6Y647 92%
Island flying fox c-mos antibody; Pteropus hypomelanus c-mos antibody Q8MIV6 100%
Island flying fox c-mos antibody; Pteropus hypomelanus c-mos antibody Q8MIV5 100%
Island flying fox c-mos antibody; Pteropus hypomelanus c-mos antibody Q8MIV4 100%
Island tube-nosed bat c-mos antibody; Nyctimene major c-mos antibody Q8MIY6 100%
isolate ts159 MOS antibody; Myeloproliferative sarcoma virus MOS antibody P10421 100%
Lesser dawn bat c-mos antibody; Eonycteris spelaea c-mos antibody Q8MIX7 100%
Lesser long-tongued fruit bat c-mos antibody; Macroglossus minimus c-mos antibody Q8MIY2 100%
Lesser long-tongued fruit bat c-mos antibody; Macroglossus minimus c-mos antibody Q8MIY1 100%
Lesser short-nosed fruit bat c-mos antibody; Cynopterus brachyotis c-mos antibody Q8MIW7 100%
Lesser short-nosed fruit bat c-mos antibody; Cynopterus brachyotis c-mos antibody Q8MIW6 92%
Lilac-breasted roller c-mos antibody; Coracias caudatus c-mos antibody Q8QH69 81%
Little brown bat MOS antibody; Myotis lucifugus MOS antibody G1PQZ6 92%
Little collared fruit bat c-mos antibody; Myonycteris torquata c-mos antibody Q8MIX6 100%
Little red flying fox c-mos antibody; Pteropus scapulatus c-mos antibody Q8MIU6 100%
little swift c-mos antibody; Apus affinis c-mos antibody Q8QH78 81%
Loggerhead shrike c-mos antibody; Lanius ludovicianus c-mos antibody Q8QH56 81%
Long-tailed fruit bat c-mos antibody; Notopteris macdonaldi c-mos antibody Q8MIX9 100%
Long-tailed fruit bat c-mos antibody; Notopteris macdonaldi c-mos antibody Q8MIX8 100%
Lowland gorilla MOS antibody; Gorilla gorilla gorilla MOS antibody G3SKC1 100%
Magnificent frigatebird c-mos antibody; Fregata magnificens c-mos antibody Q90XW4 81%
Masked flying fox c-mos antibody; Pteropus personatus c-mos antibody Q8MIU9 100%
Mauritian flying fox c-mos antibody; Pteropus niger c-mos antibody Q8MIV2 100%
Melanocharis nigra c-mos antibody Q8QH54 81%
Meliphaga analoga c-mos antibody Q8QH53 81%
Mimus patagonicus c-mos antibody Q8QH51 81%
MoMSV MOS antibody; Moloney murine sarcoma virus MOS antibody P00538 92%
MoMSV SRC antibody; Moloney murine sarcoma virus SRC antibody Q85650 92%
Mountain tube-nosed bat c-mos antibody; Nyctimene certans c-mos antibody Q8MIY7 100%
Mouse MOS antibody; Mus musculus MOS antibody P00536 100%
Mouse Mos antibody; Mus musculus Mos antibody Q78EH5 100%
Mouse Mos antibody; Mus musculus Mos antibody Q61886 100%
Mouse Mos antibody; Mus musculus Mos antibody A6H643 100%
Murine leukemia virus v-mos antibody Q8JE84 100%
Muscicapa strophiata c-mos antibody Q8QH48 81%
Nectarinia olivacea c-mos antibody Q8QH47 81%
Neomorphus geoffroyi c-mos antibody Q9PUP0 81%
New Britain naked-backed fruit bat c-mos antibody; Dobsonia praedatrix c-mos antibody Q8MIW4 100%
New Caledonian flying fox c-mos antibody; Pteropus vetulus c-mos antibody Q8MIU3 100%
Northern cardinal c-mos antibody; Cardinalis cardinalis c-mos antibody Q8QH75 81%
Northern parula c-mos antibody; Parula americana c-mos antibody Q8QH40 81%
Northern white-cheeked gibbon LOC100594874 antibody; Nomascus leucogenys LOC100594874 antibody G1S9U6 100%
Oedistoma iliolophum c-mos antibody Q8QH46 81%
Ornate flying fox c-mos antibody; Pteropus ornatus c-mos antibody Q8MIV0 100%
Pacific flying fox c-mos antibody; Pteropus tonganus c-mos antibody Q8MIU4 100%
Painted buttonquail c-mos antibody; Turnix varia c-mos antibody Q9PUQ0 81%
Pallas tube nosed bat c-mos antibody; Nyctimene cephalotes c-mos antibody Q8MIY8 100%
Panniet naked-backed fruit bat c-mos antibody; Dobsonia pannietensis c-mos antibody Q8MIW5 100%
Philadelphia vireo c-mos antibody; Vireo philadelphicus c-mos antibody Q8QH13 81%
Philippine fairy-bluebird c-mos antibody; Irena cyanogastra c-mos antibody Q8QH57 81%
Piaya melanogaster c-mos antibody Q9PUP3 81%
Pig MOS antibody; Sus scrofa MOS antibody P50118 100%
Pigmy Bryde whale c-mos antibody; Balaenoptera edeni c-mos antibody Q1XAH1 92%
Plain titmouse c-mos antibody; Parus inornatus c-mos antibody Q8QH39 81%
Przewalski partridge c-mos antibody; Alectoris magna c-mos antibody D8WN12 90%
Psarisomus dalhousiae c-mos antibody Q8QH30 81%
Pteropus capistratus ennisae c-mos antibody Q8MIV7 100%
Puerto rican vireo c-mos antibody; Vireo latimeri c-mos antibody Q9I9G2 81%
Purple swamphen c-mos antibody; Porphyrio porphyrio c-mos antibody Q90XU9 81%
Pycnonotus barbatus c-mos antibody Q8QH28 81%
Pygmy fruit bat c-mos antibody; Aethalops alecto c-mos antibody Q8MIW9 100%
Pygmy fruit bat c-mos antibody; Aethalops alecto c-mos antibody Q8MIW8 100%
Pygmy nuthatch c-mos antibody; Sitta pygmaea c-mos antibody Q8QH25 81%
Rabbit LOC100356433 antibody; Oryctolagus cuniculus LOC100356433 antibody G1TQV6 92%
Raggiana bird of paradise c-mos antibody; Paradisaea raggiana c-mos antibody Q8QH42 81%
Rat MOS antibody; Rattus norvegicus MOS antibody P00539 100%
red-backed fairy wren c-mos antibody; Malurus melanocephalus c-mos antibody Q8QH55 81%
reed bunting c-mos antibody; Emberiza schoeniclus c-mos antibody Q8QH64 81%
Rhesus macaque MOS antibody; Macaca mulatta MOS antibody F6VV07 100%
Risso dolphin c-mos antibody; Grampus griseus c-mos antibody Q6Y653 92%
Ruby-crowned kinglet c-mos antibody; Regulus calendula c-mos antibody Q8QH27 81%
Rufous babbler c-mos antibody; Pomatostomus isidorei c-mos antibody Q8QH32 81%
rufous-sided broadbill c-mos antibody; Smithornis rufolateralis c-mos antibody Q8QH24 81%
Saltator striatipectus c-mos antibody Q9I8L3 81%
Samoan flying fox c-mos antibody; Pteropus samoensis c-mos antibody Q8MIU7 100%
satin bowerbird c-mos antibody; Ptilonorhynchus violaceus c-mos antibody Q8QH29 81%
Sclater whistler c-mos antibody; Pachycephala soror c-mos antibody Q8QH43 81%
Semipalmated plover c-mos antibody; Charadrius semipalmatus c-mos antibody Q90XU8 81%
shoebill c-mos antibody; Balaeniceps rex c-mos antibody Q90XW2 81%
Silky anteater c-mos antibody; Cyclopes didactylus c-mos antibody Q2TVE6 92%
Small-eared galago MOS antibody; Otolemur garnettii MOS antibody H0X3V1 92%
Smooth-billed ani c-mos antibody; Crotophaga ani c-mos antibody Q9PUP2 81%
Solomons flying fox c-mos antibody; Pteropus rayneri c-mos antibody Q8MIU8 100%
Southern blossom bat c-mos antibody; Syconycteris australis c-mos antibody Q8MIY3 100%
Southern blossom bat c-mos antibody; Syconycteris australis c-mos antibody Q8MHW7 100%
Speckled mousebird c-mos antibody; Colius striatus c-mos antibody Q9PUP6 81%
Sperm whale c-mos antibody; Physeter macrocephalus c-mos antibody Q1XAG9 92%
Starling c-mos antibody; Sturnus vulgaris c-mos antibody Q8QH23 81%
strain HT-1 MOS antibody; Moloney murine sarcoma virus MOS antibody P07331 100%
strain m1 MOS antibody; Moloney murine sarcoma virus MOS antibody P00537 100%
strain ts110 MOS antibody; Moloney murine sarcoma virus MOS antibody P32593 92%
Straw-colored fruit bat c-mos antibody; Eidolon helvum c-mos antibody Q8MIX4 100%
Striated pardalote c-mos antibody; Pardalotus striatus c-mos antibody Q8QH41 81%
Striped dolphin c-mos antibody; Stenella coeruleoalba c-mos antibody Q6Y646 92%
superb lyrebird c-mos antibody; Menura novaehollandiae c-mos antibody Q8QH52 81%
Swift fruit bat c-mos antibody; Thoopterus nigrescens c-mos antibody Q8MHX6 100%
Tauraco persa c-mos antibody Q9PUN9 81%
Temminck flying fox c-mos antibody; Pteropus temminckii c-mos antibody Q8MIU5 100%
Tetraogallus himalayensis himalayensis c-mos antibody D8WN51 90%
Tetraogallus himalayensis koslowi c-mos antibody D8WN48 90%

Product Protocols: MOS antibody tested with Human Nci-H226 Cells (ARP56631_P050)

Aviva Systems Biology is the original manufacturer of this MOS antibody (ARP56631_P050)

Click here to view the MOS antibody Western Blot Protocol

Product Datasheet Link: MOS antibody (ARP56631_P050)

WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: NCI-H226

Western Blot image:


Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MOS antibody (ARP56631_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question