website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MOS antibody - middle region (ARP56631_P050)

  • Catalog#: ARP56631_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP56631_P050-FITC Conjugated

    ARP56631_P050-HRP Conjugated

    ARP56631_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    V-mos Moloney murine sarcoma viral oncogene homolog
    Protein Name:
    Proto-oncogene serine/threonine-protein kinase mos
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    MGC119962, MGC119963, MSV
    Replacement Item:
    This antibody may replace item sc-28789 from Santa Cruz Biotechnology.
    Description of Target:
    MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express MOS.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express MOS.
    The immunogen is a synthetic peptide directed towards the middle region of human MOS
    Species Reactivity:
    Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
    Complete computational species homology data:
    Anti-MOS (ARP56631_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-MOS (ARP56631_P050) antibody is Catalog # AAP56631 (Previous Catalog # AAPP39336)
    Datasheets / Downloads:
    Printable datasheet for anti-MOS (ARP56631_P050) antibody
    Sample Type Confirmation:

    MOS is supported by BioGPS gene expression data to be expressed in NCIH226

    Product Protocols: MOS antibody tested with Human Nci-H226 Cells (ARP56631_P050)

    Aviva Systems Biology is the original manufacturer of this MOS antibody (ARP56631_P050)

    Click here to view the MOS antibody Western Blot Protocol

    Product Datasheet Link: MOS antibody (ARP56631_P050)

    WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:12500
    Positive Control: NCI-H226

    Western Blot image:

    Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s MOS antibody (ARP56631_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question