website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

MOS antibody - middle region (ARP56631_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MOS
NCBI Gene Id:
4342
Official Gene Full Name:
V-mos Moloney murine sarcoma viral oncogene homolog
Protein Name:
Proto-oncogene serine/threonine-protein kinase mos
Swissprot Id:
P00540
Protein Accession #:
NP_005363
Nucleotide Accession #:
NM_005372
Alias Symbols:
MGC119962, MGC119963, MSV
Description of Target:
MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).
Protein Size (# AA):
346
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MOS.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MOS.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MOS
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-MOS (ARP56631_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CALCOCO2; SEC24C; HOMER3; TRAF1; TRIM27; KRT15; KRT13; KIFC3; GOLGA2; GFAP; ACTN2; LZTS2; USHBP1; CCDC33; CCDC102B; MTMR9; CCDC136; C17orf59; CCNDBP1; MID2; ATRIP; SPERT; DYDC1; KRT40; SSX2IP; HECW2; HSP90AA1; BMPR2; MYOD1; HSPA1A;
Blocking Peptide:
For anti-MOS (ARP56631_P050) antibody is Catalog # AAP56631 (Previous Catalog # AAPP39336)
Datasheets / Downloads:
Printable datasheet for anti-MOS (ARP56631_P050) antibody
Sample Type Confirmation:

MOS is supported by BioGPS gene expression data to be expressed in NCIH226

Product Protocols: MOS antibody tested with Human Nci-H226 Cells (ARP56631_P050)

Aviva Systems Biology is the original manufacturer of this MOS antibody (ARP56631_P050)

Click here to view the MOS antibody Western Blot Protocol

Product Datasheet Link: MOS antibody (ARP56631_P050)

WB Suggested Anti-MOS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: NCI-H226

Western Blot image:


Description of Target: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MOS antibody (ARP56631_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question