website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

MOS antibody - middle region (ARP56631_P050)

Description of Target:
MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).
Gene Symbol:
MOS
Official Gene Full Name:
V-mos Moloney murine sarcoma viral oncogene homolog
NCBI Gene Id:
4342
Alias Symbols:
MGC119962; MGC119963; MSV
Sample Type Confirmation:

MOS is supported by BioGPS gene expression data to be expressed in NCIH226

Tissue Tool:
Find tissues and cell lines supported to express MOS.
Protein Accession #:
NP_005363
Nucleotide Accession#:
NM_005372
Swissprot Id:
P00540
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Proto-oncogene serine/threonine-protein kinase mos
Protein Size (# AA):
346
Molecular Weight:
38kDa
Application:
WB
Partner Proteins:
DLG1
Immunogen:
The immunogen for anti-MOS antibody: synthetic peptide directed towards the middle region of human MOS
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
MOS antibody - middle region (ARP56631_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 92%; Guinea pig: 86%
Species Reactivity:
Mouse, Dog, Rat, Human, Pig, Rabbit, Bovine, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-MOS antibody
- ARP56631_P050
Peptide Sequence:
Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
Blocking Peptide:
For anti-MOS antibody is Catalog # AAP56631 (Previous Catalog # AAPP39336)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MOS antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question