MKL1 Antibody - C-terminal region (ARP37504_T100)

Catalog No: ARP37504_T100

Host: Rabbit
Target Name: MKL1
Sample Tissue: Mouse Spleen
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%; Zebrafish: 75%
• Peptide Sequence: Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-MKL1 (ARP37504_T100) antibody is Catalog # AAP37504 (Previous Catalog # AAPP09616)
• Reference: Sasazuki,T., et al., (2002) J. Biol. Chem. 277 (32), 28853-28860
• Publications:

  Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains. Cell Rep. 32, 108050 (2020). 32814053

  Mechanism of irradiation-induced mammary cancer metastasis: A role for SAP-dependent Mkl1 signaling. Mol Oncol. 9, 1510-27 (2015). 25999144

• Description:
  View product citations for MKL1 Antibody - C-terminal region (ARP37504_T100) on CiteAb

Target Info

• Gene Symbol: MKL1
• Gene Full Name: MKL (megakaryoblastic leukemia)/myocardin-like 1
• Alias Symbols: M, Bs, Mal, Mkl, AMKL, Bsac, MRTF, Mkl1, Mrtf-A
• NCBI Gene Id: 223701
• Protein Name: MKL/myocardin-like protein 1
• Description of Target: MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
• Uniprot ID: Q8K4J6
• Protein Accession #: NP_694629
• Nucleotide Accession #: NM_153049
• Protein Size (# AA): 964
• Molecular Weight: 106kDa
• Protein Interactions: Lhx2; SRF;