MERTK Antibody - N-terminal region (ARP59019_P050)

Catalog No: ARP59019_P050

Host: Rabbit
Target Name: MERTK
Sample Tissue: Human COLO205 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MERTK (ARP59019_P050) antibody is Catalog # AAP59019
• Reference: N/A

Target Info

• Gene Symbol: MERTK
• Gene Full Name: c-mer proto-oncogene tyrosine kinase
• Alias Symbols: MER, RP38, c-Eyk, c-mer, Tyro12
• NCBI Gene Id: 10461
• Protein Name: Tyrosine-protein kinase Mer
• Description of Target: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
• Uniprot ID: Q12866
• Protein Accession #: NP_006334
• Protein Size (# AA): 999
• Molecular Weight: 109kDa
• Protein Interactions: UBC; HSP90AA1; TNK2; MERTK; ITGB5; NEDD4L; IKBKG; LMO4; BMPR2; GAS6; VAV1; GRB2;