Catalog No: ARP37735_P050
Price: $0.00
SKU
ARP37735_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MED21 (ARP37735_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MED21
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: DSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALA
Concentration0.5 mg/ml
Blocking PeptideFor anti-MED21 (ARP37735_P050) antibody is Catalog # AAP37735 (Previous Catalog # AAPP08817)
Subunit21
ReferenceAndersen,J.S., (2005) Nature 433 (7021), 77-83
Gene SymbolMED21
Gene Full NameMediator complex subunit 21
Alias SymbolsSRB7, SURB7, hSrb7
NCBI Gene Id9412
Protein NameMediator of RNA polymerase II transcription subunit 21
Description of TargetMED21 belongs to the Mediator complex subunit 21 family. It is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Uniprot IDQ13503
Protein Accession #NP_004255
Nucleotide Accession #NM_004264
Protein Size (# AA)144
Molecular Weight15kDa
Protein InteractionsMAGEB4; SSC5D; ZNF655; BLOC1S6; MED21; CDK8; MED19; MED26; UBC; HTT; FBXW7; MED11; MED8; MED28; MED29; MED18; MED4; MED16; MED6; MED13; MED12; MED24; MED17; MED14; MED22; MED1; ELAVL1; VAV2; SKP1; THRA; THRB; MED10; TP53; SREBF1; ZC3H13; ZSCAN1; PCBD2; TA
  1. What is the species homology for "MED21 Antibody - middle region (ARP37735_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "MED21 Antibody - middle region (ARP37735_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MED21 Antibody - middle region (ARP37735_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MED21 Antibody - middle region (ARP37735_P050)"?

    This target may also be called "SRB7, SURB7, hSrb7" in publications.

  5. What is the shipping cost for "MED21 Antibody - middle region (ARP37735_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MED21 Antibody - middle region (ARP37735_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MED21 Antibody - middle region (ARP37735_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MED21 Antibody - middle region (ARP37735_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MED21"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MED21"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MED21"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MED21"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MED21"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MED21"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MED21 Antibody - middle region (ARP37735_P050)
Your Rating
We found other products you might like!