SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36644_P050
Price: $0.00
SKU
ARP36644_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MCM3 (ARP36644_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MCM3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 82%
Peptide SequenceSynthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
Concentration0.5 mg/ml
Blocking PeptideFor anti-MCM3 (ARP36644_P050) antibody is Catalog # AAP36644 (Previous Catalog # AAPP07901)
Sample Type Confirmation

MCM3 is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceLin,D.I., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (23), 8079-8084
Gene SymbolMCM3
Gene Full NameMinichromosome maintenance complex component 3
Alias SymbolsHCC5, P1.h, RLFB, P1-MCM3
NCBI Gene Id4172
Description of TargetMCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP25205
Protein Accession #NP_002379
Nucleotide Accession #NM_002388
Protein Size (# AA)808
Molecular Weight91kDa
Protein InteractionsSUMO2; MCMBP; UBC; KEAP1; MDM2; MCM6; MCM5; ACTBL2; MGEA5; CAP1; SAE1; HSP90B1; TPM3; HSP90AA1; FKBP5; FKBP4; MIB1; YWHAQ; UBD; TCEA1; MCM10; ORC5; ORC4; MCM2; ITGA4; FN1; CSNK2A1; CDK2; CDC6; CDC5L; PNKP; CDC7; VCAM1; NOTCH1; POLD1; POLA1; MCM7; PIPSL; P
  1. What is the species homology for "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast".

  2. How long will it take to receive "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MCM3 Antibody - C-terminal region (ARP36644_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    This target may also be called "HCC5, P1.h, RLFB, P1-MCM3" in publications.

  5. What is the shipping cost for "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "91kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MCM3 Antibody - C-terminal region (ARP36644_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MCM3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCM3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCM3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCM3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCM3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCM3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MCM3 Antibody - C-terminal region (ARP36644_P050)
Your Rating
We found other products you might like!