SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56223_P050
Price: $0.00
SKU
ARP56223_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MBP (ARP56223_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MBP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD
Concentration0.5 mg/ml
Blocking PeptideFor anti-MBP (ARP56223_P050) antibody is Catalog # AAP56223 (Previous Catalog # AAPP38141)
ReferenceZhang,Q.Y., (2008) Arch. Med. Res. 39 (1), 45-51
Gene SymbolMBP
Gene Full NameMyelin basic protein
Alias SymbolsMGC99675
NCBI Gene Id4155
Protein NameMyelin basic protein
Description of TargetThe classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. MBP induces T-cell proliferation.The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
Uniprot IDP02686
Protein Accession #NP_001020272
Nucleotide Accession #NM_001025101
Protein Size (# AA)304
Molecular Weight33kDa
Protein InteractionsCTDSP1; MAP3K3; UBC; PRKCB; MAPK3; MAPK1; ULK1; SQSTM1; PKN1; HIPK2; MNAT1; CDK9; CDK8; CDK7; CCNT1; CCNH; CCNC; MELK; DDX58; MAPK14; AT4G38520; AT4G31860; AT4G28400; ABI1; RPS6KA6; TOPP8; AT5G24940; AT5G10740; AT5G06750; AT3G17250; AT3G02750; AT3G15260;
  1. What is the species homology for "MBP Antibody - middle region (ARP56223_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "MBP Antibody - middle region (ARP56223_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MBP Antibody - middle region (ARP56223_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MBP Antibody - middle region (ARP56223_P050)"?

    This target may also be called "MGC99675" in publications.

  5. What is the shipping cost for "MBP Antibody - middle region (ARP56223_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MBP Antibody - middle region (ARP56223_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MBP Antibody - middle region (ARP56223_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MBP Antibody - middle region (ARP56223_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MBP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MBP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MBP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MBP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MBP Antibody - middle region (ARP56223_P050)
Your Rating
We found other products you might like!