website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

MB antibody - N-terminal region (ARP41558_P050)

Description of Target:
This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express MB.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
MB antibody - N-terminal region (ARP41558_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 93%; Pig: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Rat: 79%; Guinea pig: 79%
Species Reactivity:
Human, Horse, Goat, Rabbit, Pig, Sheep, Bovine, Mouse, Dog, Guinea pig, Rat
Datasheets / Downloads:
Printable datasheet for
anti-MB antibody
- ARP41558_P050
Peptide Sequence:
Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Blocking Peptide:
For anti-MB antibody is Catalog # AAP41558 (Previous Catalog # AAPP24243)
Key Reference:
Forsman,M., (2008) J. Surg. Res. 146 (2), 271-275
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MB antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question