website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

MB antibody - N-terminal region (ARP41558_P050)

Description of Target:
This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt
Gene Symbol:
MB
Official Gene Full Name:
Myoglobin
NCBI Gene Id:
4151
Alias Symbols:
MGC13548; PVALB
Tissue Tool:
Find tissues and cell lines supported to express MB.
Protein Accession #:
NP_005359
Nucleotide Accession#:
NM_005368
Swissprot Id:
P02144
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Myoglobin
Protein Size (# AA):
154
Molecular Weight:
17kDa
Application:
WB
Immunogen:
The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
MB antibody - N-terminal region (ARP41558_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 93%; Pig: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Rat: 79%; Guinea pig: 79%
Species Reactivity:
Human, Horse, Goat, Rabbit, Pig, Sheep, Bovine, Mouse, Dog, Guinea pig, Rat
Datasheets / Downloads:
Printable datasheet for
anti-MB antibody
- ARP41558_P050
Peptide Sequence:
Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Blocking Peptide:
For anti-MB antibody is Catalog # AAP41558 (Previous Catalog # AAPP24243)
Target Reference:
Forsman,M., (2008) J. Surg. Res. 146 (2), 271-275
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-MB antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for MB antibody (ARP41558)

Product page for MB antibody (ARP41558)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Aardvark MYG antibody; Orycteropus afer MYG antibody P02164 92%
African elephant LOC100672661 antibody; Loxodonta africana LOC100672661 antibody G5E7F2 78%
African elephant MYG antibody; Loxodonta africana MYG antibody P02187 80%
African wild dog MYG antibody; Lycaon pictus MYG antibody P02159 78%
Agile gibbon MYG antibody; Hylobates agilis MYG antibody P62734 92%
Amazon dolphin MYG antibody; Inia geoffrensis MYG antibody P02181 78%
American bison MYG antibody; Bison bison MYG antibody P86873 85%
Atlantic bottle-nosed dolphin MYG antibody; Tursiops truncatus MYG antibody P68279 78%
Australian echidna MYG antibody; Tachyglossus aculeatus aculeatus MYG antibody P02195 78%
Baikal seal MYG antibody; Phoca sibirica MYG antibody P30562 78%
Bat-eared fox MYG antibody; Otocyon megalotis MYG antibody P63114 78%
Beluga whale MYG antibody; Delphinapterus leucas MYG antibody P83682 78%
Black-lipped pika MYG antibody; Ochotona curzoniae MYG antibody Q6PL31 85%
Bornean orangutan MYG antibody; Pongo pygmaeus MYG antibody P02148 92%
Bovine MYG antibody; Bos taurus MYG antibody P02192 85%
Brown-capped capuchin MYG antibody; Cebus apella MYG antibody P02153 92%
California sealion MYG antibody; Zalophus californianus MYG antibody P02161 85%
Cape fox MYG antibody; Vulpes chama MYG antibody P02160 78%
Chicken MYG antibody; Gallus gallus MYG antibody P02197 78%
Chimpanzee MYG antibody; Pan troglodytes MYG antibody P02145 100%
Chinese hamster Myoglobin antibody; Cricetulus griseus Myoglobin antibody G3ILQ5 85%
Chiru Mb antibody; Pantholops hodgsonii Mb antibody A6N8S4 85%
Common squirrel monkey MYG antibody; Saimiri sciureus MYG antibody P02155 92%
Common turkey LOC100539180 antibody; Meleagris gallopavo LOC100539180 antibody G1NJB6 78%
Common woolly monkey MYG antibody; Lagothrix lagotricha MYG antibody P02154 92%
Crab-eating macaque MYG antibody; Macaca fascicularis MYG antibody P02150 92%
Cuvier beaked whale MYG antibody; Ziphius cavirostris MYG antibody P02182 78%
Dall porpoise MYG antibody; Phocoenoides dalli dalli MYG antibody P68277 78%
Dog MB antibody; Canis familiaris MB antibody F1P8V6 78%
Dog MYG antibody; Canis familiaris MYG antibody P63113 78%
Domestic water buffalo MYG antibody; Bubalus bubalis MYG antibody P84997 78%
Duckbill platypus MYG antibody; Ornithorhynchus anatinus MYG antibody P02196 85%
Dwarf sperm whale MYG antibody; Kogia sima MYG antibody P02184 78%
Egyptian rousette MYG antibody; Rousettus aegyptiacus MYG antibody P02163 100%
Eurasian badger MYG antibody; Meles meles MYG antibody P02157 85%
Eurasian beaver MYG antibody; Castor fiber MYG antibody P14396 85%
European river otter MYG antibody; Lutra lutra MYG antibody P11343 85%
Giant panda LOC100477416 antibody; Ailuropoda melanoleuca LOC100477416 antibody D2HSS2 85%
Giant panda MYG antibody; Ailuropoda melanoleuca MYG antibody Q7M3C1 85%
Goat MYG antibody; Capra hircus MYG antibody B7U9B5 85%
Gray seal MYG antibody; Halichoerus grypus MYG antibody P68081 78%
Greater galago MYG antibody; Otolemur crassicaudatus MYG antibody P02168 78%
Guaira spiny rat MYG antibody; Proechimys guairae MYG antibody P04249 78%
Guinea pig LOC100713515 antibody; Cavia porcellus LOC100713515 antibody H0V8S3 78%
Hanuman langur MYG antibody; Semnopithecus entellus MYG antibody P68085 92%
Harbor porpoise MYG antibody; Phocoenoides phocoena MYG antibody P68278 78%
Harbor seal MYG antibody; Phoca vitulina MYG antibody P68080 78%
Horse MYG antibody; Equus caballus MYG antibody P68082 92%
Hubb beaked whale MYG antibody; Mesoplodon carlhubbsi MYG antibody P02183 78%
Human MB antibody; Homo sapiens MB antibody F2Z337 100%
Human MB antibody; Homo sapiens MB antibody F2Z2F1 100%
Human MB antibody; Homo sapiens MB antibody B0QYF8 100%
Human MYG antibody; Homo sapiens MYG antibody P02144 100%
Little brown bat MB antibody; Myotis lucifugus MB antibody G1PMI1 92%
Longman beaked whale MYG antibody; Indopacetus pacificus MYG antibody Q0KIY9 78%
Lowland gorilla MB antibody; Gorilla gorilla gorilla MB antibody G3R764 92%
Middle East blind mole rat MYG antibody; Spalax ehrenbergi MYG antibody P04248 76%
Mountain gorilla MYG antibody; Gorilla gorilla beringei MYG antibody P02147 92%
Mouse Mb antibody; Mus musculus Mb antibody Q3UVB1 84%
Mouse MYG antibody; Mus musculus MYG antibody P04247 84%
Muskrat MYG antibody; Ondatra zibethicus MYG antibody P32428 78%
Night monkey MYG antibody; Aotus trivirgatus MYG antibody P02151 84%
North American opossum MYG antibody; Didelphis marsupialis virginiana MYG antibody P02193 100%
Northern gundi MYG antibody; Ctenodactylus gundi MYG antibody P20856 85%
Northern white-cheeked gibbon LOC100587737 antibody; Nomascus leucogenys LOC100587737 antibody G1RW45 92%
Olive baboon MYG antibody; Papio anubis MYG antibody P68084 92%
Pantropical spotted dolphin MYG1 antibody; Stenella attenuata MYG1 antibody Q0KIY7 78%
Pantropical spotted dolphin MYG2 antibody; Stenella attenuata MYG2 antibody Q0KIY6 78%
Pig MYG antibody; Sus scrofa MYG antibody P02189 85%
Plains viscacha MYG antibody; Lagostomus maximus MYG antibody P04250 85%
Plains zebra MYG antibody; Equus burchelli MYG antibody P68083 92%
Potto MYG antibody; Perodicticus potto edwarsi MYG antibody P02166 78%
Pygmy sperm whale MYG antibody; Kogia breviceps MYG antibody Q0KIY5 78%
Rabbit MYG antibody; Oryctolagus cuniculus MYG antibody P02170 85%
Rat MYG antibody; Rattus norvegicus MYG antibody Q9QZ76 76%
Red deer MYG antibody; Cervus elaphus MYG antibody P02191 85%
Red guenon MYG antibody; Erythrocebus patas MYG antibody P68086 92%
Rhesus macaque MB antibody; Macaca mulatta MB antibody F7ARV1 92%
Saddleback dolphin MYG antibody; Delphinus delphis MYG antibody P68276 78%
Sheep MYG antibody; Ovis aries MYG antibody P02190 85%
Siamang MYG antibody; Hylobates syndactylus MYG antibody P62735 92%
Slow loris MYG antibody; Nycticebus coucang MYG antibody P02167 78%
Small-eared galago MB antibody; Otolemur garnettii MB antibody H0WSI7 78%
Southern American pika MYG antibody; Ochotona princeps MYG antibody P02171 85%
Southern Israeli blind subterranean mole rat Mb antibody; Spalax carmeli Mb antibody A9JIH7 76%
Stejneger beaked whale MYG antibody; Mesoplodon stejnegeri MYG antibody Q0KIY0 78%
Tasmanian devil MB antibody; Sarcophilus harrisii MB antibody G3VUH4 100%
Tree shrew MYG antibody; Tupaia glis MYG antibody P02165 85%
Weasel lemur MYG antibody; Lepilemur mustelinus MYG antibody P02169 85%
Western European hedgehog MYG antibody; Erinaceus europaeus MYG antibody P02156 100%
White-tufted-ear marmoset LOC100414708 antibody; Callithrix jacchus LOC100414708 antibody F6PMG4 92%
White-tufted-ear marmoset MYG antibody; Callithrix jacchus MYG antibody P02152 92%
Wild yak MYG antibody; Bos mutus grunniens MYG antibody Q2MJN4 85%

Product Protocols: MB antibody tested with Human Ht1080 Cells (ARP41558_P050)

Aviva Systems Biology is the original manufacturer of this MB antibody (ARP41558_P050)

Click here to view the MB antibody Western Blot Protocol

Product Datasheet Link: MB antibody (ARP41558_P050)

WB Suggested Anti-MB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080

Western Blot image:


Description of Target: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MB antibody (ARP41558_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question