website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

MB antibody - N-terminal region (ARP41558_P050)

Description of Target:
This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MB.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
MB antibody - N-terminal region (ARP41558_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Horse: 93%; Pig: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Rat: 79%; Guinea pig: 79%
Species Reactivity:
Human, Horse, Goat, Rabbit, Pig, Sheep, Bovine, Mouse, Dog, Guinea pig, Rat
Datasheets / Downloads:
Printable datasheet for
anti-MB antibody
- ARP41558_P050
Peptide Sequence:
Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Blocking Peptide:
For anti-MB antibody is Catalog # AAP41558 (Previous Catalog # AAPP24243)
Target Reference:
Forsman,M., (2008) J. Surg. Res. 146 (2), 271-275
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: MB antibody tested with Human Ht1080 Cells (ARP41558_P050)

Aviva Systems Biology is the original manufacturer of this MB antibody (ARP41558_P050)

Click here to view the MB antibody Western Blot Protocol

Product Datasheet Link: MB antibody (ARP41558_P050)

WB Suggested Anti-MB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080

Western Blot image:

Description of Target: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MB antibody (ARP41558_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question