website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MB antibody - N-terminal region (ARP41558_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP41558_P050-FITC Conjugated

ARP41558_P050-HRP Conjugated

ARP41558_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101520 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MB.
The immunogen is a synthetic peptide directed towards the N terminal region of human MB
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Goat: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 79%; Sheep: 86%
Complete computational species homology data:
Anti-MB (ARP41558_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MB (ARP41558_P050) antibody is Catalog # AAP41558 (Previous Catalog # AAPP24243)
Datasheets / Downloads:
Printable datasheet for anti-MB (ARP41558_P050) antibody
Target Reference:
Forsman,M., (2008) J. Surg. Res. 146 (2), 271-275

Product Protocols: MB antibody tested with Human Ht1080 Cells (ARP41558_P050)

Aviva Systems Biology is the original manufacturer of this MB antibody (ARP41558_P050)

Click here to view the MB antibody Western Blot Protocol

Product Datasheet Link: MB antibody (ARP41558_P050)

WB Suggested Anti-MB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080

Western Blot image:

Description of Target: This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alt

Questions pertaining to this data can be directed to

Aviva Systems Biology’s MB antibody (ARP41558_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question