SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38146_P050
Price: $0.00
SKU
ARP38146_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MAZ (ARP38146_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAZ (ARP38146_P050) antibody is Catalog # AAP38146 (Previous Catalog # AAPP10733)
Sample Type Confirmation

MAZ is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Enhanced Validation
WBY
SPR
YCHAROS
ReferenceRay,B.K., (2007) J. Immunol. 178 (3), 1774-1782
Publications

Smits, M. et al. Myc-associated zinc finger protein (MAZ) is regulated by miR-125b and mediates VEGF-induced angiogenesis in glioblastoma. FASEB J. 26, 2639-47 (2012). 22415301

Gene SymbolMAZ
Gene Full NameMYC-associated zinc finger protein (purine-binding transcription factor)
Alias SymbolsPUR1, ZF87, Pur-1, SAF-1, SAF-2, SAF-3, Zif87, ZNF801
NCBI Gene Id4150
Protein NameMyc-associated zinc finger protein
Description of TargetMAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
Uniprot IDP56270
Protein Accession #NP_002374
Nucleotide Accession #NM_002383
Protein Size (# AA)477
Molecular Weight49 kDa
Protein InteractionsHECW2; MAPK14; BPTF; JUN; FOS; KEAP1; DCC; CSNK2A1;
  1. What is the species homology for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Pig".

  2. How long will it take to receive "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAZ Antibody - N-terminal region (ARP38146_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    This target may also be called "PUR1, ZF87, Pur-1, SAF-1, SAF-2, SAF-3, Zif87, ZNF801" in publications.

  5. What is the shipping cost for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "49 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAZ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAZ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAZ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAZ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAZ Antibody - N-terminal region (ARP38146_P050)
Your Rating
We found other products you might like!