MAPK1 Antibody - C-terminal region (ARP58899_P050)

Catalog No: ARP58899_P050

WB Suggested Anti-MAPK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Host: Rat
Target Name: MAPK1
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml

Rabbit Anti-MAPK1 Antibody
Catalog Number: ARP58899_P050
Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MAPK1 (ARP58899_P050) antibody is Catalog # AAP58899 (Previous Catalog # AAPP44846)
• Sample Type Confirmation:

  MAPK1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

Target Info

• Gene Symbol: MAPK1
• Gene Full Name: Mitogen-activated protein kinase 1
• Alias Symbols: ERK, p38, p40, p41, ERK2, ERT1, NS13, ERK-2, MAPK2, PRKM1, PRKM2, P42MAPK, p41mapk, p42-MAPK
• NCBI Gene Id: 5594
• Protein Name: Mitogen-activated protein kinase 1
• Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
• Uniprot ID: P28482
• Protein Accession #: NP_620407
• Nucleotide Accession #: NM_138957
• Protein Size (# AA): 360
• Molecular Weight: 41 kDa
• Protein Interactions: Eif4ebp1; ATF2; RPS6KA3; RAF1; PTGDR; MAP2K6; MAP2K1; MAPK3; HDAC6; TP53; NEDD8; DGCR8; HMGB1; NAV1; PDCD6IP; CEP350; MAPK12; RPS6KA2; MAPK1; PDE4D; MBP; KRAS; SQSTM1; CUEDC2; GAB2; BRAF; RPS6KA1; MAP2K4; MAP2K2; ELK1; NOXA1; TIAL1; GADD45A; MAP3K10; SMAD