MAP4K5 Antibody - middle region (ARP33101_P050)

Catalog No: ARP33101_P050

WB Suggested Anti-MAP4K5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAP4K5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MAP4K5 (ARP33101_P050) antibody is Catalog # AAP33101 (Previous Catalog # AAPP04134)
• Reference: Wissing,J., (2007) Mol. Cell Proteomics 6 (3), 537-547

Target Info

• Gene Symbol: MAP4K5
• Gene Full Name: Mitogen-activated protein kinase kinase kinase kinase 5
• Alias Symbols: KHS, GCKR, KHS1, MAPKKKK5
• NCBI Gene Id: 11183
• Protein Name: Mitogen-activated protein kinase kinase kinase kinase 5
• Description of Target: MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.This gene encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.
• Uniprot ID: Q9Y4K4
• Protein Accession #: NP_006566
• Nucleotide Accession #: NM_006575
• Protein Size (# AA): 846
• Molecular Weight: 95kDa
• Protein Interactions: CRK; ELAVL1; UBC; NEDD4; SETDB1; ZNF440; COPS5; HCK; GRB2; TANK; CRKL; TRAF2; ABL1; BCR;