- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-MAP4K4 (ARP49031_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Additional Information | IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml. |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K4 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MAP4K4 (ARP49031_P050) antibody is Catalog # AAP49031 (Previous Catalog # AAPY02188) |
Reference | Bouzakri,K. (2007) J. Biol. Chem. 282 (11), 7783-7789 |
Gene Symbol | MAP4K4 |
---|---|
Gene Full Name | Mitogen-activated protein kinase kinase kinase kinase 4 |
Alias Symbols | HGK, NIK, MEKKK4, FLH21957, HEL-S-31 |
NCBI Gene Id | 9448 |
Protein Name | Mitogen-activated protein kinase kinase kinase kinase 4 |
Description of Target | MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Uniprot ID | O95819 |
Protein Accession # | NP_004825 |
Nucleotide Accession # | NM_004834 |
Protein Size (# AA) | 1239 |
Molecular Weight | 142kDa |
Protein Interactions | UBC; MOB1B; NME7; PPP1CC; HSP90AA1; PAXIP1; GRK5; TRAPPC9; PPP1CA; KIF26B; HIST2H2BE; SLC9A1; PRKCE; KIF5A; ZRANB1; DOK1; MAP3K7; NCK1; GBP3; RAP2A; RASA1; ITGB1; MAP3K1; BRCA1; ATL1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MAP4K4 Antibody - N-terminal region (ARP49031_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
This target may also be called "HGK, NIK, MEKKK4, FLH21957, HEL-S-31" in publications.
-
What is the shipping cost for "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "142kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MAP4K4 Antibody - N-terminal region (ARP49031_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MAP4K4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MAP4K4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MAP4K4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MAP4K4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MAP4K4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MAP4K4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.