MAFK Antibody - N-terminal region (ARP47559_T100)

Catalog No: ARP47559_T100

WB Suggested Anti-MAFK Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAFK
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-MAFK (ARP47559_T100) antibody is Catalog # AAP47559 (Previous Catalog # AAPP28395)
• Reference: Hillier,L.W., (2003) Nature 424 (6945), 157-164

Target Info

• Gene Symbol: MAFK
• Gene Full Name: V-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
• Alias Symbols: P18, NFE2U
• NCBI Gene Id: 7975
• Protein Name: Transcription factor MafK
• Description of Target: The developmentally regulated expression of the globin genes depends on upstream regulatory elements termed locus control regions (LCRs). LCRs are associated with powerful enhancer activity that is mediated by the transcription factor NFE2. NFE2 recognition sites are also present in the gene promoters of 2 heme biosynthetic enzymes, PBGD and FECH. NFE2 DNA-binding activity consists of a heterodimer containing an 18-kD Maf protein (MafF, MafG, or MafK) and p45. Both subunits are members of the activator protein-1 superfamily of bZIP proteins. Maf homodimers suppress transcription at NFE2 sites.The developmentally regulated expression of the globin genes depends on upstream regulatory elements termed locus control regions (LCRs). LCRs are associated with powerful enhancer activity that is mediated by the transcription factor NFE2 (nuclear factor erythroid-2). NFE2 recognition sites are also present in the gene promoters of 2 heme biosynthetic enzymes, porphobilinogen deaminase (PBGD; MIM 176000) and ferrochelatase (FECH; MIM 177000). NFE2 DNA-binding activity consists of a heterodimer containing an 18-kD Maf protein (MafF, MafG (MIM 602020), or MafK) and p45 (MIM 601490). Both subunits are members of the activator protein-1 superfamily of basic leucine zipper (bZIP) proteins (see MIM 165160). Maf homodimers suppress transcription at NFE2 sites.[supplied by OMIM].
• Uniprot ID: O60675
• Protein Accession #: NP_002351
• Nucleotide Accession #: NM_002360
• Protein Size (# AA): 156
• Molecular Weight: 17kDa
• Protein Interactions: NFE2L2; SMAD3; PARP1; HIF1A; UBC; SUMO2; Bach1; HDAC3; HDAC2; HDAC1; CREBBP; RELA; KAT6A; TP53; BACH2; NFE2L3; NFE2; MARS; MAFK; NFE2L1; HOXD12;