LYVE1 Antibody - N-terminal region (ARP46761_P050)

Catalog No: ARP46761_P050

WB Suggested Anti-LYVE1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYVE1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 77%
• Peptide Sequence: Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LYVE1 (ARP46761_P050) antibody is Catalog # AAP46761 (Previous Catalog # AAPP27560)
• Reference: Ishikawa,Y., (2008) Cancer 112 (4), 924-933

Target Info

• Gene Symbol: LYVE1
• Gene Full Name: Lymphatic vessel endothelial hyaluronan receptor 1
• Alias Symbols: HAR, XLKD1, LYVE-1, CRSBP-1
• NCBI Gene Id: 10894
• Protein Name: Lymphatic vessel endothelial hyaluronic acid receptor 1
• Description of Target: LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9Y5Y7
• Protein Accession #: NP_006682
• Nucleotide Accession #: NM_006691
• Protein Size (# AA): 322
• Molecular Weight: 35kDa
• Protein Interactions: KRTAP10-3; KRTAP10-8; VEGFA; PDGFB;