LYCAT Antibody - middle region (ARP44426_P050)

Catalog No: ARP44426_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: LYCAT
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYCAT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LCLAT1 (ARP44426_P050) antibody is Catalog # AAP44426 (Previous Catalog # AAPP25736)
• Reference: Wang,C., (2007) Blood 110 (10), 3601-3609
• Publications:

  LPS impairs oxygen utilization in epithelia by triggering degradation of the mitochondrial enzyme Alcat1. J. Cell. Sci. 129, 51-64 (2016). 26604221

Target Info

• Gene Symbol: LCLAT1
• Gene Full Name: Lysocardiolipin acyltransferase 1
• Alias Symbols: LYCAT, AGPAT8, ALCAT1, 1AGPAT8, UNQ1849, HSRG1849
• NCBI Gene Id: 253558
• Protein Name: cDNA FLJ61482, highly similar to Homo sapiens lysocardiolipin acyltransferase (LYCAT), transcript variant 1, mRNA EMBL BAG63827.1
• Description of Target: LYCAT is an acyl-CoA:lysocardiolipin acyltransferase. It possesses both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. LYCAT recognizes both monolysocardiolipin and dilysocardiolipin as substrates with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. LYCAT acts as a remodeling enzyme for cardiolipin, a major membrane polyglycerophospholipid. It converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) with a relatively low activity. LYCAT is required for establishment of the hematopoietic and endothelial lineages.
• Uniprot ID: Q6UWP7
• Protein Accession #: NP_001002257
• Nucleotide Accession #: NM_001002257
• Protein Size (# AA): 376
• Molecular Weight: 44kDa
• Protein Interactions: LNX1; GOPC; RNF2; UBC; ELAVL1;