Catalog No: ARP52475_P050
Price: $0.00
SKU
ARP52475_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LRG1 (ARP52475_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LRG1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Human: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
Concentration0.5 mg/ml
Blocking PeptideFor anti-LRG1 (ARP52475_P050) antibody is Catalog # AAP52475 (Previous Catalog # AAPP42935)
Publications

O’Hanlon, T. P. et al. Plasma proteomic profiles from disease-discordant monozygotic twins suggest that molecular pathways are shared in multiple systemic autoimmune diseases. Arthritis Res. Ther. 13, R181 (2011). 22044644

Gene SymbolLRG1
Gene Full NameLeucine-rich alpha-2-glycoprotein 1
Alias SymbolsLRG, HMFT1766
NCBI Gene Id116844
Protein NameLeucine-rich alpha-2-glycoprotein
Description of TargetThe leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (O'Donnell et al., 2002 [PubMed 12223515]).
Uniprot IDP02750
Protein Accession #NP_443204
Nucleotide Accession #NM_052972
Protein Size (# AA)347
Molecular Weight38kDa
Protein InteractionsFN1;
  1. What is the species homology for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Pig".

  2. How long will it take to receive "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LRG1 Antibody - N-terminal region (ARP52475_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    This target may also be called "LRG, HMFT1766" in publications.

  5. What is the shipping cost for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LRG1 Antibody - N-terminal region (ARP52475_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LRG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LRG1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LRG1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LRG1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LRG1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LRG1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LRG1 Antibody - N-terminal region (ARP52475_P050)
Your Rating
We found other products you might like!